Western Blot (WB)
(WB Suggested Anti-CALN1 AntibodyTitration: 1.0 ug/mlPositive Control: COLO205 Whole Cell)
Rabbit CALN1 Polyclonal Antibody | anti-CALN1 antibody
CALN1 Antibody - N-terminal region
Gene Names
CALN1; CABP8
Reactivity
Cow, Guinea Pig, Human, Mouse, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
CALN1; Polyclonal Antibody; CALN1 Antibody - N-terminal region; anti-CALN1 antibody
Host
Rabbit
Reactivity
Cow, Guinea Pig, Human, Mouse, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: PGEGKPENEKKGDGGALGGGEEPPRSQAPDFPTWEKMPFHHVTAGLLYKG
Sequence Length
261
Applicable Applications for anti-CALN1 antibody
Western Blot (WB)
Homology
Cow: 91%; Guinea Pig: 92%; Human: 100%; Mouse: 83%; Rat: 83%
Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of Human CALN1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(WB Suggested Anti-CALN1 AntibodyTitration: 1.0 ug/mlPositive Control: COLO205 Whole Cell)
Western Blot (WB)
(WB Suggested Anti-CALN1 AntibodyTitration: 1.0 ug/mlPositive Control: COLO205 Whole Cell)
Related Product Information for anti-CALN1 antibody
This is a rabbit polyclonal antibody against CALN1. It was validated on Western Blot
Target Description: This gene encodes a protein with high similarity to the calcium-binding proteins of the calmodulin family. The encoded protein contains two EF-hand domains and potential calcium-binding sites. Alternative splicing results in multiple transcript variants.
Target Description: This gene encodes a protein with high similarity to the calcium-binding proteins of the calmodulin family. The encoded protein contains two EF-hand domains and potential calcium-binding sites. Alternative splicing results in multiple transcript variants.
Product Categories/Family for anti-CALN1 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
29kDa
NCBI Official Full Name
calcium-binding protein 8 isoform 1
NCBI Official Synonym Full Names
calneuron 1
NCBI Official Symbol
CALN1
NCBI Official Synonym Symbols
CABP8
NCBI Protein Information
calcium-binding protein 8
UniProt Protein Name
Calcium-binding protein 8
Protein Family
UniProt Gene Name
CALN1
UniProt Synonym Gene Names
CABP8; CaBP8
UniProt Entry Name
CABP8_HUMAN
NCBI Description
This gene encodes a protein with high similarity to the calcium-binding proteins of the calmodulin family. The encoded protein contains two EF-hand domains and potential calcium-binding sites. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2008]
Uniprot Description
CALN1: Negatively regulates Golgi-to-plasma membrane trafficking by interacting with PI4KB and inhibiting its activity. May play a role in the physiology of neurons and is potentially important in memory and learning.
Protein type: Membrane protein, integral
Chromosomal Location of Human Ortholog: 7q11
Cellular Component: perinuclear region of cytoplasm; integral to membrane; plasma membrane; trans-Golgi network membrane
Molecular Function: calcium ion binding
Research Articles on CALN1
Similar Products
Product Notes
The CALN1 caln1 (Catalog #AAA3215625) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CALN1 Antibody - N-terminal region reacts with Cow, Guinea Pig, Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's CALN1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the CALN1 caln1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: PGEGKPENEK KGDGGALGGG EEPPRSQAPD FPTWEKMPFH HVTAGLLYKG. It is sometimes possible for the material contained within the vial of "CALN1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
