Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: SEMA7ASample Type: 721_BAntibody Dilution: 1.0ug/mlSEMA7A is supported by BioGPS gene expression data to be expressed in 721_B)

Rabbit SEMA7A Polyclonal Antibody | anti-SEMA7A antibody

SEMA7A Antibody - C-terminal region

Gene Names
SEMA7A; JMH; CD108; SEMAL; CDw108; SEMAK1; H-Sema-L; H-SEMA-K1
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
SEMA7A; Polyclonal Antibody; SEMA7A Antibody - C-terminal region; anti-SEMA7A antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: SIYSSERSVLQSINPAEPHKECPNPKPDKAPLQKVSLAPNSRYYLSCPME
Sequence Length
666
Applicable Applications for anti-SEMA7A antibody
Western Blot (WB)
Homology
Cow: 79%; Dog: 100%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 92%; Rat: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Human SEMA7A
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: SEMA7ASample Type: 721_BAntibody Dilution: 1.0ug/mlSEMA7A is supported by BioGPS gene expression data to be expressed in 721_B)

Western Blot (WB) (Host: RabbitTarget Name: SEMA7ASample Type: 721_BAntibody Dilution: 1.0ug/mlSEMA7A is supported by BioGPS gene expression data to be expressed in 721_B)

Western Blot (WB)

(WB Suggested Anti-SEMA7A AntibodyTitration: 1.0 ug/mlPositive Control: MDA-MB-435S Whole CellSEMA7A is supported by BioGPS gene expression data to be expressed in MDA-MB435)

Western Blot (WB) (WB Suggested Anti-SEMA7A AntibodyTitration: 1.0 ug/mlPositive Control: MDA-MB-435S Whole CellSEMA7A is supported by BioGPS gene expression data to be expressed in MDA-MB435)
Related Product Information for anti-SEMA7A antibody
This is a rabbit polyclonal antibody against SEMA7A. It was validated on Western Blot

Target Description: The protein encoded by this gene binds to cell surfaces through a glycosylphosphatidylinositol (GPI) linkage. The encoded glycoprotein is found on activated lymphocytes and erythrocytes. This protein may be involved in immunomodulatory and neuronal processes. Defects in this gene can result in loss of bone mineral density (BMD). Three transcript variants encoding different isoforms have been found for this gene.
Product Categories/Family for anti-SEMA7A antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
68kDa
NCBI Official Full Name
semaphorin-7A isoform 1 preproprotein
NCBI Official Synonym Full Names
semaphorin 7A (John Milton Hagen blood group)
NCBI Official Symbol
SEMA7A
NCBI Official Synonym Symbols
JMH; CD108; SEMAL; CDw108; SEMAK1; H-Sema-L; H-SEMA-K1
NCBI Protein Information
semaphorin-7A
UniProt Protein Name
Semaphorin-7A
Protein Family
UniProt Gene Name
SEMA7A
UniProt Synonym Gene Names
CD108; SEMAL; Sema K1; Sema L
UniProt Entry Name
SEM7A_HUMAN

NCBI Description

This gene encodes a member of the semaphorin family of proteins. The encoded preproprotein is proteolytically processed to generate the mature glycosylphosphatidylinositol (GPI)-anchored membrane glycoprotein. The encoded protein is found on activated lymphocytes and erythrocytes and may be involved in immunomodulatory and neuronal processes. The encoded protein carries the John Milton Hagen (JMH) blood group antigens. Mutations in this gene may be associated with reduced bone mineral density (BMD). Alternative splicing results in multiple transcript variants, at least one of which encodes an isoform that is proteolytically processed. [provided by RefSeq, Feb 2016]

Uniprot Description

SEMA7A: Plays an important role in integrin-mediated signaling and functions both in regulating cell migration and immune responses. Promotes formation of focal adhesion complexes, activation of the protein kinase PTK2/FAK1 and subsequent phosphorylation of MAPK1 and MAPK3. Promotes production of proinflammatory cytokines by monocytes and macrophages. Plays an important role in modulating inflammation and T-cell-mediated immune responses. Promotes axon growth in the embryonic olfactory bulb. Promotes attachment, spreading and dendrite outgrowth in melanocytes. Belongs to the semaphorin family.

Protein type: Membrane protein, GPI anchor

Chromosomal Location of Human Ortholog: 15q22.3-q23

Cellular Component: membrane; plasma membrane; external side of plasma membrane

Molecular Function: integrin binding; protein binding; receptor activity

Biological Process: integrin-mediated signaling pathway; osteoblast differentiation; axon guidance; axon extension; positive regulation of axon extension; regulation of inflammatory response; immune response; olfactory lobe development; positive regulation of protein amino acid phosphorylation; inflammatory response

Disease: Blood Group, John Milton Hagen System

Research Articles on SEMA7A

Similar Products

Product Notes

The SEMA7A sema7a (Catalog #AAA3216390) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SEMA7A Antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's SEMA7A can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the SEMA7A sema7a for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: SIYSSERSVL QSINPAEPHK ECPNPKPDKA PLQKVSLAPN SRYYLSCPME. It is sometimes possible for the material contained within the vial of "SEMA7A, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.