Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Immunohistochemistry (IHC) (Human kidney)

Rabbit CAV1 Polyclonal Antibody | anti-CAV1 antibody

CAV1 antibody - N-terminal region

Gene Names
CAV1; CGL3; PPH3; BSCL3; LCCNS; VIP21; MSTP085
Reactivity
Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep
Applications
Immunohistochemistry, Western Blot
Purity
Protein A purified
Synonyms
CAV1; Polyclonal Antibody; CAV1 antibody - N-terminal region; anti-CAV1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: MSGGKYVDSEGHLYTVPIREQGNIYKPNNKAMADELSEKQVYDAHTKEID
Sequence Length
178
Applicable Applications for anti-CAV1 antibody
Immunohistochemistry (IHC), Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human CAV1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Immunohistochemistry (IHC)

(Human kidney)

Immunohistochemistry (IHC) (Human kidney)
Related Product Information for anti-CAV1 antibody
This is a rabbit polyclonal antibody against CAV1. It was validated on Western Blot and immunohistochemistry

Target Description: The scaffolding protein is the main component of the caveolae plasma membranes found in most cell types. The protein links integrin subunits to the tyrosine kinase FYN, an initiating step in coupling integrins to the Ras-ERK pathway and promoting cell cycle progression.The scaffolding protein encoded by this gene is the main component of the caveolae plasma membranes found in most cell types. The protein links integrin subunits to the tyrosine kinase FYN, an initiating step in coupling integrins to the Ras-ERK pathway and promoting cell cycle progression. The gene is a tumor suppressor gene candidate and a negative regulator of the Ras-p42/44 MAP kinase cascade. CAV1 and CAV2 are located next to each other on chromosome 7 and express colocalizing proteins that form a stable hetero-oligomeric complex. By using alternative initiation codons in the same reading frame, two isoforms (alpha and beta) are encoded by a single transcript from this gene.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
857
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
20kDa
NCBI Official Full Name
caveolin-1 isoform alpha
NCBI Official Synonym Full Names
caveolin 1
NCBI Official Symbol
CAV1
NCBI Official Synonym Symbols
CGL3; PPH3; BSCL3; LCCNS; VIP21; MSTP085
NCBI Protein Information
caveolin-1
UniProt Protein Name
Caveolin-1
Protein Family
UniProt Gene Name
CAV1
UniProt Synonym Gene Names
CAV
UniProt Entry Name
CAV1_HUMAN

NCBI Description

The scaffolding protein encoded by this gene is the main component of the caveolae plasma membranes found in most cell types. The protein links integrin subunits to the tyrosine kinase FYN, an initiating step in coupling integrins to the Ras-ERK pathway and promoting cell cycle progression. The gene is a tumor suppressor gene candidate and a negative regulator of the Ras-p42/44 mitogen-activated kinase cascade. Caveolin 1 and caveolin 2 are located next to each other on chromosome 7 and express colocalizing proteins that form a stable hetero-oligomeric complex. Mutations in this gene have been associated with Berardinelli-Seip congenital lipodystrophy. Alternatively spliced transcripts encode alpha and beta isoforms of caveolin 1.[provided by RefSeq, Mar 2010]

Uniprot Description

Caveolin-1: May act as a scaffolding protein within caveolar membranes. Interacts directly with G-protein alpha subunits and can functionally regulate their activity. Involved in the costimulatory signal essential for T-cell receptor (TCR)- mediated T-cell activation. Its binding to DPP4 induces T-cell proliferation and NF-kappa-B activation in a T-cell receptor/CD3- dependent manner. Recruits CTNNB1 to caveolar membranes and may regulate CTNNB1-mediated signaling through the Wnt pathway. Homooligomer. Interacts with GLIPR2, NOSTRIN, SNAP25 and syntaxin. Interacts with rotavirus A NSP4. Interacts (via the N- terminus) with DPP4; the interaction is direct. Interacts with CTNNB1, CDH1 and JUP. Interacts with BMX and BTK. Expressed in muscle and lung, less so in liver, brain and kidney. Belongs to the caveolin family. 2 isoforms of the human protein are produced by alternative initiation.

Protein type: Adaptor/scaffold; Nuclear receptor co-regulator; Motility/polarity/chemotaxis

Chromosomal Location of Human Ortholog: 7q31.1

Cellular Component: protein complex; focal adhesion; endoplasmic reticulum; basolateral plasma membrane; integral to plasma membrane; lipid particle; caveola; cell cortex; lipid raft; cilium; acrosomal membrane; Golgi membrane; perinuclear region of cytoplasm; early endosome membrane; apical plasma membrane; plasma membrane; cytoplasmic vesicle; intracellular; endosome

Molecular Function: identical protein binding; protein binding; enzyme binding; protease activator activity; cholesterol binding; patched binding; protein complex scaffold; nitric-oxide synthase binding; structural molecule activity; protein kinase binding; receptor binding

Biological Process: mammary gland involution; viral reproduction; negative regulation of epithelial cell differentiation; negative regulation of tyrosine phosphorylation of Stat5 protein; nitric oxide homeostasis; negative regulation of BMP signaling pathway; calcium ion homeostasis; sequestering of lipid; protein localization; regulation of the force of heart contraction by chemical signal; regulation of fatty acid metabolic process; negative regulation of protein binding; inactivation of MAPK activity; regulation of smooth muscle contraction; maintenance of cellular protein localization; skeletal muscle development; cytosolic calcium ion homeostasis; negative regulation of nitric-oxide synthase activity; cellular response to starvation; membrane depolarization; cholesterol homeostasis; response to estrogen stimulus; negative regulation of endothelial cell proliferation; T cell costimulation; negative regulation of protein ubiquitination; regulation of nitric-oxide synthase activity; response to calcium ion; response to progesterone stimulus; leukocyte migration; negative regulation of JAK-STAT cascade; lactation; vesicle organization and biogenesis; negative regulation of peptidyl-serine phosphorylation; negative regulation of pinocytosis; negative regulation of transcription from RNA polymerase II promoter; nitric oxide metabolic process; mammary gland development; calcium ion transport; negative regulation of cytokine and chemokine mediated signaling pathway; angiogenesis; vasculogenesis; protein homooligomerization; vasoconstriction; cholesterol transport; negative regulation of MAPKKK cascade; negative regulation of nitric oxide biosynthetic process; MAPKKK cascade; positive regulation of metalloenzyme activity; positive regulation of peptidyl-serine phosphorylation; regulation of peptidase activity; cellular calcium ion homeostasis; triacylglycerol metabolic process; regulation of blood coagulation; positive regulation of vasoconstriction; response to hypoxia; blood coagulation; vascular endothelial growth factor receptor signaling pathway

Disease: Lipodystrophy, Congenital Generalized, Type 3; Partial Lipodystrophy, Congenital Cataracts, And Neurodegeneration Syndrome; Pulmonary Hypertension, Primary, 3

Research Articles on CAV1

Similar Products

Product Notes

The CAV1 cav1 (Catalog #AAA3224440) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CAV1 antibody - N-terminal region reacts with Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep and may cross-react with other species as described in the data sheet. AAA Biotech's CAV1 can be used in a range of immunoassay formats including, but not limited to, Immunohistochemistry (IHC), Western Blot (WB). Researchers should empirically determine the suitability of the CAV1 cav1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: MSGGKYVDSE GHLYTVPIRE QGNIYKPNNK AMADELSEKQ VYDAHTKEID. It is sometimes possible for the material contained within the vial of "CAV1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.