Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: CARD8Sample Type: Fetal spleen lysatesAntibody Dilution: 1.0ug/ml)

Rabbit anti-Human CARD8 Polyclonal Antibody | anti-CARD8 antibody

CARD8 Antibody - N-terminal region

Gene Names
CARD8; NDPP; DACAR; DAKAR; NDPP1; TUCAN; CARDINAL
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
CARD8; Polyclonal Antibody; CARD8 Antibody - N-terminal region; anti-CARD8 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: LGGTFPGDICSEENQIVSSYASKVCFEIEEDYKNRQFLGPEGNVDVELID
Sequence Length
286
Applicable Applications for anti-CARD8 antibody
Western Blot (WB)
Homology
Human: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of Human CARD8
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: CARD8Sample Type: Fetal spleen lysatesAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: CARD8Sample Type: Fetal spleen lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-CARD8 antibody
This is a rabbit polyclonal antibody against CARD8. It was validated on Western Blot

Target Description: The protein encoded by this gene belongs to the caspase recruitment domain (CARD)-containing family of proteins, which are involved in pathways leading to activation of caspases or nuclear factor kappa-B (NFKB). This protein may be a component of the inflammasome, a protein complex that plays a role in the activation of proinflammatory caspases. It is thought that this protein acts as an adaptor molecule that negatively regulates NFKB activation, CASP1-dependent IL1B secretion, and apoptosis. Polymorphisms in this gene may be associated with a susceptibility to rheumatoid arthritis. Alternatively spliced transcript variants have been described for this gene.
Product Categories/Family for anti-CARD8 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
31kDa
NCBI Official Full Name
Caspase recruitment domain-containing protein 8
NCBI Official Synonym Full Names
caspase recruitment domain family member 8
NCBI Official Symbol
CARD8
NCBI Official Synonym Symbols
NDPP; DACAR; DAKAR; NDPP1; TUCAN; CARDINAL
NCBI Protein Information
caspase recruitment domain-containing protein 8
UniProt Protein Name
Caspase recruitment domain-containing protein 8
UniProt Gene Name
CARD8
UniProt Synonym Gene Names
KIAA0955; NDPP1; CARDINAL; TUCAN
UniProt Entry Name
CARD8_HUMAN

NCBI Description

The protein encoded by this gene belongs to the caspase recruitment domain (CARD)-containing family of proteins, which are involved in pathways leading to activation of caspases or nuclear factor kappa-B (NFKB). This protein may be a component of the inflammasome, a protein complex that plays a role in the activation of proinflammatory caspases. It is thought that this protein acts as an adaptor molecule that negatively regulates NFKB activation, CASP1-dependent IL1B secretion, and apoptosis. Polymorphisms in this gene may be associated with a susceptibility to rheumatoid arthritis. Alternatively spliced transcript variants have been described for this gene. [provided by RefSeq, May 2010]

Uniprot Description

CARD8: Inhibits NF-kappa-B activation. May participate in a regulatory mechanism that coordinates cellular responses controlled by NF-kappa-B transcription factor. May be a component of the inflammasome, a protein complex which also includes PYCARD, NALP2 and CASP1 and whose function would be the activation of proinflammatory caspases. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Apoptosis; Inhibitor

Chromosomal Location of Human Ortholog: 19q13.33

Cellular Component: nucleoplasm; cytoplasm; nucleus

Molecular Function: NACHT domain binding; protein binding; protein homodimerization activity; caspase activator activity

Biological Process: caspase activation; positive regulation of caspase activity; negative regulation of I-kappaB kinase/NF-kappaB cascade; positive regulation of interleukin-1 beta secretion

Research Articles on CARD8

Similar Products

Product Notes

The CARD8 card8 (Catalog #AAA3212067) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CARD8 Antibody - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CARD8 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the CARD8 card8 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: LGGTFPGDIC SEENQIVSSY ASKVCFEIEE DYKNRQFLGP EGNVDVELID. It is sometimes possible for the material contained within the vial of "CARD8, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.