Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-CARD17 AntibodyTitration: 1.0 ug/mlPositive Control: Jurkat Whole Cell)

Rabbit anti-Human CARD17 Polyclonal Antibody | anti-CARD17 antibody

CARD17 antibody - middle region

Gene Names
CARD17; INCA
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
CARD17; Polyclonal Antibody; CARD17 antibody - middle region; anti-CARD17 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: MDKARALLDSVIRKGAPACQICITYICEEDSHLAGTLGLSAGPTSGNHLT
Sequence Length
110
Applicable Applications for anti-CARD17 antibody
Western Blot (WB)
Homology
Human: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human CARD17
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-CARD17 AntibodyTitration: 1.0 ug/mlPositive Control: Jurkat Whole Cell)

Western Blot (WB) (WB Suggested Anti-CARD17 AntibodyTitration: 1.0 ug/mlPositive Control: Jurkat Whole Cell)
Related Product Information for anti-CARD17 antibody
This is a rabbit polyclonal antibody against CARD17. It was validated on Western Blot

Target Description: As a regulator of procaspase-1/CASP1 activation, CARD17 is implicated in the regulation of the proteolytic maturation of pro-IL-1beta/IL1B and its release during inflammation. CARD17 inhibits the release of IL1B in response to LPS in monocytes. However, unlike CASP1, CARD17 do not induce NF-kappa-B activation.
Product Categories/Family for anti-CARD17 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
12kDa
NCBI Official Full Name
caspase recruitment domain-containing protein 17
NCBI Official Synonym Full Names
caspase recruitment domain family member 17
NCBI Official Symbol
CARD17
NCBI Official Synonym Symbols
INCA
NCBI Protein Information
caspase recruitment domain-containing protein 17
UniProt Protein Name
Caspase recruitment domain-containing protein 17
UniProt Gene Name
CARD17
UniProt Synonym Gene Names
INCA
UniProt Entry Name
CAR17_HUMAN

Uniprot Description

CARD17: Regulator of procaspase-1/CASP1 activation implicated in the regulation of the proteolytic maturation of pro-IL-1beta/IL1B and its release during inflammation. Inhibits the release of IL1B in response to LPS in monocytes. However, unlike CASP1, do not induce NF-kappa-B activation.

Chromosomal Location of Human Ortholog: 11q22.3

Cellular Component: cytoplasm

Molecular Function: cysteine protease inhibitor activity

Biological Process: regulation of apoptosis

Research Articles on CARD17

Similar Products

Product Notes

The CARD17 card17 (Catalog #AAA3215132) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CARD17 antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CARD17 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the CARD17 card17 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: MDKARALLDS VIRKGAPACQ ICITYICEED SHLAGTLGLS AGPTSGNHLT. It is sometimes possible for the material contained within the vial of "CARD17, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.