Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-CAPN3 AntibodyTitration: 1.0 ug/mlPositive Control: HT1080 Whole Cell)

Rabbit CAPN3 Polyclonal Antibody | anti-CAPN3 antibody

CAPN3 antibody - middle region

Gene Names
CAPN3; p94; CANP3; LGMD2; nCL-1; CANPL3; LGMD2A; LGMDD4; LGMDR1
Reactivity
Cow, Dog, Horse, Human, Mouse, Rat, Sheep
Applications
Western Blot
Purity
Affinity Purified
Synonyms
CAPN3; Polyclonal Antibody; CAPN3 antibody - middle region; anti-CAPN3 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Horse, Human, Mouse, Rat, Sheep
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: SPQPQPGSSDQESEEQQQFRNIFKQIAGDDMEICADELKKVLNTVVNKHK
Sequence Length
309
Applicable Applications for anti-CAPN3 antibody
Western Blot (WB)
Homology
Cow: 75%; Dog: 79%; Horse: 86%; Human: 100%; Mouse: 79%; Rat: 79%; Sheep: 75%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-CAPN3 AntibodyTitration: 1.0 ug/mlPositive Control: HT1080 Whole Cell)

Western Blot (WB) (WB Suggested Anti-CAPN3 AntibodyTitration: 1.0 ug/mlPositive Control: HT1080 Whole Cell)
Related Product Information for anti-CAPN3 antibody
This is a rabbit polyclonal antibody against CAPN3. It was validated on Western Blot

Target Description: Calpain, a heterodimer consisting of a large and a small subunit, is a major intracellular protease, although its function has not been well established. This gene encodes a muscle-specific member of the calpain large subunit family that specifically binds to titin. Mutations in this gene are associated with limb-girdle muscular dystrophies type 2A. Alternate promoters and alternative splicing result in multiple transcript variants encoding different isoforms and some variants are ubiquitously expressed.
Product Categories/Family for anti-CAPN3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
825
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
35kDa
NCBI Official Full Name
calpain-3 isoform d
NCBI Official Synonym Full Names
calpain 3
NCBI Official Symbol
CAPN3
NCBI Official Synonym Symbols
p94; CANP3; LGMD2; nCL-1; CANPL3; LGMD2A; LGMDD4; LGMDR1
NCBI Protein Information
calpain-3
UniProt Protein Name
Calpain-3
Protein Family
UniProt Gene Name
CAPN3
UniProt Synonym Gene Names
CANP3; CANPL3; NCL1; CANP 3; nCL-1
UniProt Entry Name
CAN3_HUMAN

NCBI Description

Calpain, a heterodimer consisting of a large and a small subunit, is a major intracellular protease, although its function has not been well established. This gene encodes a muscle-specific member of the calpain large subunit family that specifically binds to titin. Mutations in this gene are associated with limb-girdle muscular dystrophies type 2A. Alternate promoters and alternative splicing result in multiple transcript variants encoding different isoforms and some variants are ubiquitously expressed. [provided by RefSeq, Jul 2008]

Uniprot Description

CAPN3: Calcium-regulated non-lysosomal thiol-protease. Defects in CAPN3 are the cause of limb-girdle muscular dystrophy type 2A (LGMD2A). LGMD2A is an autosomal recessive degenerative myopathy characterized by progressive symmetrical atrophy and weakness of the proximal limb muscles and elevated serum creatine kinase. The symptoms usually begin during the first two decades of life, and the disease gradually worsens, often resulting in loss of walking ability 10 or 20 years after onset. Belongs to the peptidase C2 family. 5 isoforms of the human protein are produced by alternative splicing.

Protein type: Motility/polarity/chemotaxis; Cell development/differentiation; Protease; Calcium-binding; EC 3.4.22.54

Chromosomal Location of Human Ortholog: 15q15.1

Cellular Component: protein complex; myofibril; T-tubule; cytoplasm; plasma membrane; intracellular; cytosol; Z disc; nucleus

Molecular Function: peptidase activity; sodium ion binding; protein binding; signal transducer activity; structural constituent of muscle; titin binding; calcium-dependent cysteine-type endopeptidase activity; calcium ion binding; protein complex scaffold; catalytic activity; ligase regulator activity; cysteine-type peptidase activity

Biological Process: response to muscle activity; muscle development; apoptosis; positive regulation of proteolysis; positive regulation of transcription, DNA-dependent; positive regulation of satellite cell activation involved in skeletal muscle regeneration; sarcomere organization; signal transduction; proteolysis; negative regulation of protein sumoylation; activation of NF-kappaB transcription factor; muscle maintenance; autolysis; myofibril assembly; regulation of catalytic activity; regulation of myoblast differentiation; protein complex assembly; positive regulation of release of sequestered calcium ion into cytosol; negative regulation of transcription, DNA-dependent; response to calcium ion; regulation of I-kappaB kinase/NF-kappaB cascade; negative regulation of apoptosis

Disease: Muscular Dystrophy, Limb-girdle, Type 2a

Research Articles on CAPN3

Similar Products

Product Notes

The CAPN3 capn3 (Catalog #AAA3215020) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CAPN3 antibody - middle region reacts with Cow, Dog, Horse, Human, Mouse, Rat, Sheep and may cross-react with other species as described in the data sheet. AAA Biotech's CAPN3 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the CAPN3 capn3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: SPQPQPGSSD QESEEQQQFR NIFKQIAGDD MEICADELKK VLNTVVNKHK. It is sometimes possible for the material contained within the vial of "CAPN3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.