Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (51.04kD).)

Mouse anti-Human HSF2 Monoclonal Antibody | anti-HSF2 antibody

HSF2 (Heat Shock Factor Protein 2, HSF 2, Heat Shock Transcription Factor 2, HSTF 2, HSTF2, MGC117376, MGC156196, MGC75048) (HRP)

Gene Names
HSF2; HSF 2; HSTF 2
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
HSF2; Monoclonal Antibody; HSF2 (Heat Shock Factor Protein 2; HSF 2; Heat Shock Transcription Factor 2; HSTF 2; HSTF2; MGC117376; MGC156196; MGC75048) (HRP); anti-HSF2 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
1F11-A3
Specificity
Recognizes human HSF2.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Applicable Applications for anti-HSF2 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length recombinant corresponding to aa1-230 from human HSF2 (AAH05329) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MKQSSNVPAFLSKLWTLVEETHTNEFITWSQNGQSFLVLDEQRFAKEILPKYFKHNNMASFVRQLNMYGFRKVVHIDSGIVKQERDGPVEFQHPYFKQGQDDLLENIKRKVSSSKPEENKIRQEDLTKIISSAQKVQIKQETIESRLSELKSENESLWKEVSELRAKHAQQQQVIRKIVQFIVTLVQNNQLVSLKRKRPLLLNTNGAQKKNLFQHIVKEPTDNHHHKVIF
Conjugate
HRP
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (51.04kD).)

Western Blot (WB) (Western Blot detection against Immunogen (51.04kD).)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to HSF2 on HeLa cell. [antibody concentration 10ug/ml])

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to HSF2 on HeLa cell. [antibody concentration 10ug/ml])

Testing Data

(Detection limit for recombinant GST tagged HSF2 is ~0.3ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged HSF2 is ~0.3ng/ml as a capture antibody.)
Related Product Information for anti-HSF2 antibody
HSF2 is a DNA-binding protein that specifically binds heat shock promoter elements (HSE) and activates transcription. In higher eukaryotes, HSF is unable to bind to the HSE unless the cells are heat shocked. The protein is found as a DNA-binding homotrimer in stressed or heat shocked cells, and otherwise found as a homodimer. HSF2 is cytoplasmic during normal growth and moves to the nucleus upon activation. Sumoylation of HSF2 hinders HSF2 DNA-binding activity, without affecting its oligomerization, and is an example of negative regulation of gene expression via sumoylation.
Product Categories/Family for anti-HSF2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
Molecular Weight
58,293 Da
NCBI Official Full Name
Homo sapiens heat shock transcription factor 2, mRNA
NCBI Official Synonym Full Names
heat shock transcription factor 2
NCBI Official Symbol
HSF2
NCBI Official Synonym Symbols
HSF 2; HSTF 2
NCBI Protein Information
heat shock factor protein 2
Protein Family

NCBI Description

The protein encoded by this gene belongs to the HSF family of transcription factors that bind specifically to the heat-shock promoter element and activate transcription. Heat shock transcription factors activate heat-shock response genes under conditions of heat or other stresses. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2011]

Research Articles on HSF2

Similar Products

Product Notes

The HSF2 (Catalog #AAA6152971) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The HSF2 (Heat Shock Factor Protein 2, HSF 2, Heat Shock Transcription Factor 2, HSTF 2, HSTF2, MGC117376, MGC156196, MGC75048) (HRP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's HSF2 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the HSF2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "HSF2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.