Western Blot (WB)
(Host: RabbitTarget Name: CAPN14Sample Type: MCF7 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)
Rabbit anti-Human CAPN14 Polyclonal Antibody | anti-CAPN14 antibody
CAPN14 Antibody - middle region
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
CAPN14; Polyclonal Antibody; CAPN14 Antibody - middle region; anti-CAPN14 antibody
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: ILEAHQKSEFVLRVFSRKHIFYEIGSNSGVVFSKEIEDQNERQDEFFTKF
Sequence Length
508
Applicable Applications for anti-CAPN14 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of Human CAPN14
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(Host: RabbitTarget Name: CAPN14Sample Type: MCF7 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)
Western Blot (WB)
(Host: RabbitTarget Name: CAPN14Sample Type: MCF7 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-CAPN14 antibody
This is a rabbit polyclonal antibody against CAPN14. It was validated on Western Blot
Target Description: Calpains are a family of cytosolic calcium-activated cysteine proteases involved in a variety of cellular processes including apoptosis, cell division, modulation of integrin-cytoskeletal interactions, and synaptic plasticity (Dear et al., 2000 [PubMed 10964513]). CAPN14 belongs to the calpain large subunit family.
Target Description: Calpains are a family of cytosolic calcium-activated cysteine proteases involved in a variety of cellular processes including apoptosis, cell division, modulation of integrin-cytoskeletal interactions, and synaptic plasticity (Dear et al., 2000 [PubMed 10964513]). CAPN14 belongs to the calpain large subunit family.
Product Categories/Family for anti-CAPN14 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
55kDa
NCBI Official Synonym Full Names
calpain 14
NCBI Official Symbol
CAPN14
NCBI Protein Information
calpain-14
UniProt Protein Name
Calpain-14
Protein Family
UniProt Gene Name
CAPN14
UniProt Synonym Gene Names
CANP 14
UniProt Entry Name
CAN14_HUMAN
NCBI Description
Calpains are a family of cytosolic calcium-activated cysteine proteases involved in a variety of cellular processes including apoptosis, cell division, modulation of integrin-cytoskeletal interactions, and synaptic plasticity (Dear et al., 2000 [PubMed 10964513]). CAPN14 belongs to the calpain large subunit family.[supplied by OMIM, Mar 2008]
Research Articles on CAPN14
Similar Products
Product Notes
The CAPN14 capn14 (Catalog #AAA3215018) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CAPN14 Antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CAPN14 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the CAPN14 capn14 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: ILEAHQKSEF VLRVFSRKHI FYEIGSNSGV VFSKEIEDQN ERQDEFFTKF. It is sometimes possible for the material contained within the vial of "CAPN14, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
