Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-CAPN11 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Human Muscle)

Rabbit CAPN11 Polyclonal Antibody | anti-CAPN11 antibody

CAPN11 antibody - N-terminal region

Gene Names
CAPN11; calpain11
Reactivity
Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
CAPN11; Polyclonal Antibody; CAPN11 antibody - N-terminal region; anti-CAPN11 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: NNSRLKAKGVGQHDNAQNFGNQSFEELRAACLRKGELFEDPLFPAEPSSL
Sequence Length
702
Applicable Applications for anti-CAPN11 antibody
Western Blot (WB)
Homology
Cow: 85%; Dog: 100%; Goat: 85%; Guinea Pig: 93%; Horse: 86%; Human: 100%; Mouse: 77%; Rabbit: 93%; Rat: 91%; Sheep: 85%; Zebrafish: 92%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human CAPN11
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-CAPN11 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Human Muscle)

Western Blot (WB) (WB Suggested Anti-CAPN11 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Human Muscle)
Related Product Information for anti-CAPN11 antibody
This is a rabbit polyclonal antibody against CAPN11. It was validated on Western Blot

Target Description: Calpains constitute a family of intracellular calcium-dependent cysteine proteases. There are eight members in this superfamily. They consist of a variable 80 kDa subunit and an invariant 30 kDa subunit. This calpain protein appears to have protease activity and calcium-binding ability. A similar mouse protein may play a functional role in spermatogenesis and in the regulation of calcium-dependent signal transduction events during meiosis.
Product Categories/Family for anti-CAPN11 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
80kDa
NCBI Official Full Name
calpain-11
NCBI Official Synonym Full Names
calpain 11
NCBI Official Symbol
CAPN11
NCBI Official Synonym Symbols
calpain11
NCBI Protein Information
calpain-11
UniProt Protein Name
Calpain-11
Protein Family
UniProt Gene Name
CAPN11
UniProt Synonym Gene Names
CANP 11
UniProt Entry Name
CAN11_HUMAN

NCBI Description

Calpains constitute a family of intracellular calcium-dependent cysteine proteases. There are eight members in this superfamily. They consist of a variable 80 kDa subunit and an invariant 30 kDa subunit. This calpain protein appears to have protease activity and calcium-binding ability. A similar mouse protein may play a functional role in spermatogenesis and in the regulation of calcium-dependent signal transduction events during meiosis. [provided by RefSeq, Dec 2008]

Uniprot Description

CAPN11: Calcium-regulated non-lysosomal thiol-protease which catalyzes limited proteolysis of substrates involved in cytoskeletal remodeling and signal transduction. Belongs to the peptidase C2 family.

Protein type: Protease; EC 3.4.22.-

Chromosomal Location of Human Ortholog: 6p12

Cellular Component: cytoplasm; acrosome

Molecular Function: peptidase activity; calcium-dependent cysteine-type endopeptidase activity; calcium ion binding

Biological Process: proteolysis

Research Articles on CAPN11

Similar Products

Product Notes

The CAPN11 capn11 (Catalog #AAA3210704) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CAPN11 antibody - N-terminal region reacts with Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's CAPN11 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the CAPN11 capn11 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: NNSRLKAKGV GQHDNAQNFG NQSFEELRAA CLRKGELFED PLFPAEPSSL. It is sometimes possible for the material contained within the vial of "CAPN11, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.