Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-CAPN10 AntibodyTitration: 1.0 ug/mlPositive Control: PANC1 Whole Cell)

Rabbit CAPN10 Polyclonal Antibody | anti-CAPN10 antibody

CAPN10 antibody - N-terminal region

Gene Names
CAPN10; CANP10; NIDDM1
Reactivity
Dog, Guinea Pig, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
CAPN10; Polyclonal Antibody; CAPN10 antibody - N-terminal region; anti-CAPN10 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Dog, Guinea Pig, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: RRPQEICATPRLFPDDPREGQVKQGLLGDCWFLCACAALQKSRHLLDQVI
Sequence Length
672
Applicable Applications for anti-CAPN10 antibody
Western Blot (WB)
Homology
Dog: 79%; Guinea Pig: 86%; Human: 100%; Mouse: 86%; Rabbit: 86%; Rat: 86%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-CAPN10 AntibodyTitration: 1.0 ug/mlPositive Control: PANC1 Whole Cell)

Western Blot (WB) (WB Suggested Anti-CAPN10 AntibodyTitration: 1.0 ug/mlPositive Control: PANC1 Whole Cell)
Related Product Information for anti-CAPN10 antibody
This is a rabbit polyclonal antibody against CAPN10. It was validated on Western Blot

Target Description: CAPN10 is the calcium-regulated non-lysosomal thiol-protease which catalyzes limited proteolysis of substrates involved in cytoskeletal remodeling and signal transduction.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
75kDa
NCBI Official Full Name
calpain-10 isoform a
NCBI Official Synonym Full Names
calpain 10
NCBI Official Symbol
CAPN10
NCBI Official Synonym Symbols
CANP10; NIDDM1
NCBI Protein Information
calpain-10
UniProt Protein Name
Calpain-10
Protein Family
UniProt Gene Name
CAPN10
UniProt Synonym Gene Names
KIAA1845; CANP 10
UniProt Entry Name
CAN10_HUMAN

NCBI Description

Calpains represent a ubiquitous, well-conserved family of calcium-dependent cysteine proteases. The calpain proteins are heterodimers consisting of an invariant small subunit and variable large subunits. The large catalytic subunit has four domains: domain I, the N-terminal regulatory domain that is processed upon calpain activation; domain II, the protease domain; domain III, a linker domain of unknown function; and domain IV, the calmodulin-like calcium-binding domain. This gene encodes a large subunit. It is an atypical calpain in that it lacks the calmodulin-like calcium-binding domain and instead has a divergent C-terminal domain. It is similar in organization to calpains 5 and 6. This gene is associated with type 2 or non-insulin-dependent diabetes mellitus (NIDDM), and is located within the NIDDM1 region. Multiple alternative transcript variants have been described for this gene. [provided by RefSeq, Sep 2010]

Uniprot Description

CAPN10: Calcium-regulated non-lysosomal thiol-protease which catalyze limited proteolysis of substrates involved in cytoskeletal remodeling and signal transduction. Defects in CAPN10 are a cause of susceptibility to diabetes mellitus non-insulin-dependent type 1 (NIDDM1). It is a multifactorial disorder of glucose homeostasis caused by a lack of sensitivity to the body's own insulin. Affected individuals usually have an obese body habitus and manifestations of a metabolic syndrome characterized by diabetes, insulin resistance, hypertension and hypertriglyceridemia. The disease results in long-term complications that affect the eyes, kidneys, nerves, and blood vessels. Belongs to the peptidase C2 family. 8 isoforms of the human protein are produced by alternative splicing.

Protein type: Apoptosis; EC 3.4.22.-; Protease; Mitochondrial

Chromosomal Location of Human Ortholog: 2q37.3

Cellular Component: mitochondrion; cell; plasma membrane; cytosol

Molecular Function: SNARE binding; cytoskeletal protein binding; calcium-dependent cysteine-type endopeptidase activity

Biological Process: positive regulation of glucose import; cellular response to insulin stimulus; positive regulation of intracellular transport; actin cytoskeleton reorganization; positive regulation of insulin secretion; proteolysis; cell structure disassembly during apoptosis

Disease: Diabetes Mellitus, Noninsulin-dependent, 1

Research Articles on CAPN10

Similar Products

Product Notes

The CAPN10 capn10 (Catalog #AAA3210772) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CAPN10 antibody - N-terminal region reacts with Dog, Guinea Pig, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's CAPN10 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the CAPN10 capn10 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: RRPQEICATP RLFPDDPREG QVKQGLLGDC WFLCACAALQ KSRHLLDQVI. It is sometimes possible for the material contained within the vial of "CAPN10, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.