Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Researcher: DR. Kimilia Kent, Emory UniversityApplication: Western blottingSpecies + Tissue/Cell type: Rat Inner Medulla ~ 17.5 ugHow many ug's of tissue/cell lysate run on the gel:1. 17.5 ug rat inner medulla lysate2. 17.5 ug rat inner medulla lysate3. 17.5 ug rat inner medulla lysate4. 17.5 ug rat inner medulla lysate5. 17.5 ug rat inner medulla lysate6. 17.5 ug rat inner medulla lysatePrimary antibody dilution: 1:2000Secondary antibody: Alexa 680 goat anti-rabbitSecondary antibody dilution: 1:4000)

Rabbit CANX Polyclonal Antibody | anti-CANX antibody

CANX antibody - C-terminal region

Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
CANX; Polyclonal Antibody; CANX antibody - C-terminal region; anti-CANX antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: RPWLWVVYILTVALPVFLVILFCCSGKKQTSGMEYKKTDAPQPDVKEEEE
Sequence Length
592
Applicable Applications for anti-CANX antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 93%; Rabbit: 100%; Rat: 100%; Zebrafish: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human CANX
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Researcher: DR. Kimilia Kent, Emory UniversityApplication: Western blottingSpecies + Tissue/Cell type: Rat Inner Medulla ~ 17.5 ugHow many ug's of tissue/cell lysate run on the gel:1. 17.5 ug rat inner medulla lysate2. 17.5 ug rat inner medulla lysate3. 17.5 ug rat inner medulla lysate4. 17.5 ug rat inner medulla lysate5. 17.5 ug rat inner medulla lysate6. 17.5 ug rat inner medulla lysatePrimary antibody dilution: 1:2000Secondary antibody: Alexa 680 goat anti-rabbitSecondary antibody dilution: 1:4000)

Western Blot (WB) (Researcher: DR. Kimilia Kent, Emory UniversityApplication: Western blottingSpecies + Tissue/Cell type: Rat Inner Medulla ~ 17.5 ugHow many ug's of tissue/cell lysate run on the gel:1. 17.5 ug rat inner medulla lysate2. 17.5 ug rat inner medulla lysate3. 17.5 ug rat inner medulla lysate4. 17.5 ug rat inner medulla lysate5. 17.5 ug rat inner medulla lysate6. 17.5 ug rat inner medulla lysatePrimary antibody dilution: 1:2000Secondary antibody: Alexa 680 goat anti-rabbitSecondary antibody dilution: 1:4000)

Western Blot (WB)

(WB Suggested Anti-CANX Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: A549 cell lysateCANX is strongly supported by BioGPS gene expression data to be expressed in Human A549 cells)

Western Blot (WB) (WB Suggested Anti-CANX Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: A549 cell lysateCANX is strongly supported by BioGPS gene expression data to be expressed in Human A549 cells)
Related Product Information for anti-CANX antibody
This is a rabbit polyclonal antibody against CANX. It was validated on Western Blot

Target Description: This gene encodes a member of the calnexin family of molecular chaperones. The encoded protein is a calcium-binding, endoplasmic reticulum (ER)-associated protein that interacts transiently with newly synthesized N-linked glycoproteins, facilitating protein folding and assembly. It may also play a central role in the quality control of protein folding by retaining incorrectly folded protein subunits within the ER for degradation. Alternatively spliced transcript variants encoding the same protein have been described.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
821
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
65kDa
NCBI Official Full Name
calnexin isoform d
UniProt Protein Name
Calnexin
UniProt Gene Name
CANX
UniProt Entry Name
CALX_HUMAN

Uniprot Description

Calnexin: a calcium-binding protein of the calreticulin family. A type I membrane protein of the endoplasmic reticulum .Interacts with newly synthesized glycoproteins in the endoplasmic reticulum. May act in assisting protein assembly and/or in the retention within the ER of unassembled protein subunits. It seems to play a major role in the quality control apparatus of the ER by the retention of incorrectly folded proteins.

Protein type: Endoplasmic reticulum; Calcium-binding; Motility/polarity/chemotaxis; Membrane protein, integral

Chromosomal Location of Human Ortholog: 5q35

Cellular Component: dendrite cytoplasm; endoplasmic reticulum membrane; smooth endoplasmic reticulum; protein complex; rough endoplasmic reticulum; endoplasmic reticulum; endoplasmic reticulum lumen; dendritic spine; cell soma; membrane; axon; melanosome; ribosome

Molecular Function: ionotropic glutamate receptor binding; protein binding; unfolded protein binding; apolipoprotein binding; calcium ion binding; glycoprotein binding; carbohydrate binding

Biological Process: antigen processing and presentation of peptide antigen via MHC class I; cellular protein metabolic process; protein folding; synaptic vesicle endocytosis; protein secretion; antigen processing and presentation of exogenous peptide antigen via MHC class II; protein amino acid N-linked glycosylation via asparagine; post-translational protein modification; aging

Similar Products

Product Notes

The CANX canx (Catalog #AAA3214490) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CANX antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's CANX can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the CANX canx for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: RPWLWVVYIL TVALPVFLVI LFCCSGKKQT SGMEYKKTDA PQPDVKEEEE. It is sometimes possible for the material contained within the vial of "CANX, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.