Rabbit anti-Mouse APOBEC1 Polyclonal Antibody | anti-APOBEC1 antibody

APOBEC1 Polyclonal Antibody

Cat. Num. AAA9140983

• Gene Names: APOBEC1; BEDP; HEPR; CDAR1; APOBEC-1
• Reactivity: Mouse
• Applications: Western Blot
• Purity: Affinity Purification
• Synonyms: APOBEC1; Polyclonal Antibody; APOBEC1 Polyclonal Antibody; APOBEC-1; BEDP; CDAR1; HEPR; C->U-editing enzyme APOBEC-1; anti-APOBEC1 antibody

• Host: Rabbit
• Reactivity: Mouse
• Clonality: Polyclonal
• Isotype: IgG
• Purity/Purification: Affinity Purification
• Form/Format: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
• Concentration: 3.14 mg/ml (varies by lot)
• Sequence Length: 223

• Applicable Applications for anti-APOBEC1 antibody: Western Blot (WB)
• Application Notes: WB: 1:500-1:2000
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-80 of human APOBEC1 (NP_001291495).
• Immunogen Sequence: MTSEKGPSTGDPTLRRRIEPWEFDVFYDPRELRKEACLLYEIKWGMSRKIWRSSGKNTTNHVEVNFIKKFTSERDFHPSM
• Preparation and Storage: Store at -20 degree C. Avoid freeze/thaw cycles.

Western Blot (WB)

(Western blot-APOBEC1 Polyclonal Antibody)

Related Product Information for anti-APOBEC1 antibody

This gene encodes a member of the cytidine deaminase enzyme family. The encoded protein forms a multiple-protein editing holoenzyme with APOBEC1 complementation factor (ACF) and APOBEC1 stimulating protein (ASP). This holoenzyme is involved in the editing of C-to-U nucleotide bases in apolipoprotein B and neurofibromatosis-1 mRNAs. Multiple transcript variants encoding different isoforms have been found for this gene.

NCBI and Uniprot Product Information

• NCBI GI #: 75517354
• NCBI GeneID: 339
• UniProt Accession #: P41238
• Molecular Weight: 28kDa
• NCBI Official Full Name: APOBEC1 protein, partial
• NCBI Official Synonym Full Names: apolipoprotein B mRNA editing enzyme catalytic subunit 1
• NCBI Official Symbol: APOBEC1
• NCBI Official Synonym Symbols: BEDP; HEPR; CDAR1; APOBEC-1
• NCBI Protein Information: C->U-editing enzyme APOBEC-1
• UniProt Protein Name: C->U-editing enzyme APOBEC-1
• Protein Family: APOBEC1 complementation factor
• UniProt Gene Name: APOBEC1
• UniProt Entry Name: ABEC1_HUMAN

NCBI Description

This gene encodes a member of the cytidine deaminase enzyme family. The encoded protein forms a multiple-protein editing holoenzyme with APOBEC1 complementation factor (ACF) and APOBEC1 stimulating protein (ASP). This holoenzyme is involved in the editing of C-to-U nucleotide bases in apolipoprotein B and neurofibromatosis-1 mRNAs. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Feb 2015]

Uniprot Description

Function: Catalytic component of the apolipoprotein B mRNA editing enzyme complex which is responsible for the postranscriptional editing of a CAA codon for Gln to a UAA codon for stop in the APOB mRNA. Also involved in CGA (Arg) to UGA (Stop) editing in the NF1 mRNA. May also play a role in the epigenetic regulation of gene expression by participating in DNA demethylation. Ref.8

Cofactor: Zinc

By similarity.

Subunit structure: Homodimer. Part of the apolipoprotein B mRNA editing complex with A1CF. Found in a complex with CELF2/CUGBP2 and A1CF. Interacts with HNRPAB and SYNCRIP. Ref.6 Ref.7

Subcellular location: Cytoplasm Ref.9.

Tissue specificity: Expressed exclusively in the small intestine.

Sequence similarities: Belongs to the cytidine and deoxycytidylate deaminase family.