Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-CAMK2G AntibodyTitration: 1.0 ug/mlPositive Control: THP-1 Whole Cell)

Rabbit CAMK2G Polyclonal Antibody | anti-CAMK2G antibody

CAMK2G antibody - C-terminal region

Gene Names
CAMK2G; CAMK; CAMKG; CAMK-II
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
CAMK2G; Polyclonal Antibody; CAMK2G antibody - C-terminal region; anti-CAMK2G antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: SRNFSAAKSLLNKKSDGGVKPQSNNKNSLEPQTTVVHNATDGIKGSTESC
Sequence Length
504
Applicable Applications for anti-CAMK2G antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 86%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-CAMK2G AntibodyTitration: 1.0 ug/mlPositive Control: THP-1 Whole Cell)

Western Blot (WB) (WB Suggested Anti-CAMK2G AntibodyTitration: 1.0 ug/mlPositive Control: THP-1 Whole Cell)
Related Product Information for anti-CAMK2G antibody
This is a rabbit polyclonal antibody against CAMK2G. It was validated on Western Blot

Target Description: The product of this gene is one of the four subunits of an enzyme which belongs to the serine/threonine protein kinase family, and to the Ca(2+)/calmodulin-dependent protein kinase subfamily. Calcium signaling is crucial for several aspects of plasticity at glutamatergic synapses. In mammalian cells the enzyme is composed of four different chains: alpha, beta, gamma, and delta. The product of this gene is a gamma chain. Many alternatively spliced transcripts encoding different isoforms have been described but the full-length nature of all the variants has not been determined.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
818
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
55kDa
NCBI Official Full Name
calcium/calmodulin-dependent protein kinase type II subunit gamma isoform 6
NCBI Official Synonym Full Names
calcium/calmodulin dependent protein kinase II gamma
NCBI Official Symbol
CAMK2G
NCBI Official Synonym Symbols
CAMK; CAMKG; CAMK-II
NCBI Protein Information
calcium/calmodulin-dependent protein kinase type II subunit gamma
UniProt Protein Name
Calcium/calmodulin-dependent protein kinase type II subunit gamma
UniProt Gene Name
CAMK2G
UniProt Synonym Gene Names
CAMK; CAMK-II; CAMKG; CaM kinase II subunit gamma; CaMK-II subunit gamma
UniProt Entry Name
KCC2G_HUMAN

NCBI Description

The product of this gene is one of the four subunits of an enzyme which belongs to the serine/threonine protein kinase family, and to the Ca(2+)/calmodulin-dependent protein kinase subfamily. Calcium signaling is crucial for several aspects of plasticity at glutamatergic synapses. In mammalian cells the enzyme is composed of four different chains: alpha, beta, gamma, and delta. The product of this gene is a gamma chain. Many alternatively spliced transcripts encoding different isoforms have been described but the full-length nature of all the variants has not been determined.[provided by RefSeq, Mar 2011]

Uniprot Description

CAMK2G: a protein kinase of the CAMK2 family. A prominent kinase in the central nervous system that may function in long-term potentiation and neurotransmitter release. Member of the NMDAR signaling complex in excitatory synapses that may regulate NMDAR-dependent potentiation of the AMPAR and synaptic plasticity. The holoenzyme is composed of four different chains: alpha, beta, gamma, and delta. The different chains assemble into homo- or heteromultimeric holoenzymes composed of 8 to 12 subunits. May interact with BAALC, MPDZ, SYN1 and synGAP. 4 isoforms of the human protein are produced by alternative splicing.

Protein type: Protein kinase, Ser/Thr (non-receptor); Kinase, protein; EC 2.7.11.17; Protein kinase, CAMK; CAMK group; CAMK2 family

Chromosomal Location of Human Ortholog: 10q22

Cellular Component: nucleoplasm; sarcoplasmic reticulum membrane; membrane; plasma membrane; cytosol

Molecular Function: calmodulin binding; protein binding; protein homodimerization activity; calcium-dependent protein serine/threonine phosphatase activity; calmodulin-dependent protein kinase activity; ATP binding

Biological Process: nervous system development; synaptic transmission; dephosphorylation; regulation of skeletal muscle adaptation; insulin secretion; calcium ion transport; protein amino acid autophosphorylation; cytokine and chemokine mediated signaling pathway; regulation of calcium ion transport; cell differentiation; protein oligomerization; G1/S transition of mitotic cell cycle

Research Articles on CAMK2G

Similar Products

Product Notes

The CAMK2G camk2g (Catalog #AAA3215820) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CAMK2G antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's CAMK2G can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the CAMK2G camk2g for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: SRNFSAAKSL LNKKSDGGVK PQSNNKNSLE PQTTVVHNAT DGIKGSTESC. It is sometimes possible for the material contained within the vial of "CAMK2G, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.