Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: CAMK2DSample Tissue: Human THP-1 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Rabbit anti-Human CAMK2D Polyclonal Antibody | anti-CAMK2D antibody

CAMK2D Antibody - C-terminal region

Gene Names
CAMK2D; CAMKD
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
CAMK2D; Polyclonal Antibody; CAMK2D Antibody - C-terminal region; anti-CAMK2D antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: YIRLTQYMDGSGMPKTMQSEETRVWHRRDGKWQNVHFHRSGSPTVPIKPP
Sequence Length
478
Applicable Applications for anti-CAMK2D antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human CAMK2D
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: CAMK2DSample Tissue: Human THP-1 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: CAMK2DSample Tissue: Human THP-1 Whole Cell lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-CAMK2D antibody
The product of this gene belongs to the serine/threonine protein kinase family and to the Ca(2+)/calmodulin-dependent protein kinase subfamily. Calcium signaling is crucial for several aspects of plasticity at glutamatergic synapses. In mammalian cells, the enzyme is composed of four different chains: alpha, beta, gamma, and delta. The product of this gene is a delta chain. Alternative splicing results in multiple transcript variants encoding distinct isoforms. Distinct isoforms of this chain have different expression patterns.
Product Categories/Family for anti-CAMK2D antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
817
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
52 kDa
NCBI Official Full Name
calcium/calmodulin-dependent protein kinase type II subunit delta isoform 3
NCBI Official Synonym Full Names
calcium/calmodulin dependent protein kinase II delta
NCBI Official Symbol
CAMK2D
NCBI Official Synonym Symbols
CAMKD
NCBI Protein Information
calcium/calmodulin-dependent protein kinase type II subunit delta
UniProt Protein Name
Calcium/calmodulin-dependent protein kinase type II subunit delta
UniProt Gene Name
CAMK2D
UniProt Synonym Gene Names
CAMKD; CaM kinase II subunit delta; CaMK-II subunit delta
UniProt Entry Name
KCC2D_HUMAN

NCBI Description

The product of this gene belongs to the serine/threonine protein kinase family and to the Ca(2+)/calmodulin-dependent protein kinase subfamily. Calcium signaling is crucial for several aspects of plasticity at glutamatergic synapses. In mammalian cells, the enzyme is composed of four different chains: alpha, beta, gamma, and delta. The product of this gene is a delta chain. Alternative splicing results in multiple transcript variants encoding distinct isoforms. Distinct isoforms of this chain have different expression patterns.[provided by RefSeq, Nov 2008]

Uniprot Description

CAMK2D: a protein kinase of the calcium/calmodulin-dependent protein kinase (CAMK) group that interacts with the sarcoplasmic reticulum membrane in cardiac and skeletal muscle. Regulates Ca2+ homeostatis and excitation-contraction coupling (ECC) in heart. Calmodulin binding induces conformational changes that relieve autoinhibition, permitting autophosphorylation at T287, rendering the kinase constitutively active and independent of Ca2+-binding. Targets ion channels, transporters and accessory proteins involved in Ca2+ influx into the myocyte, Ca2+ release from the sarcoplasmic reticulum (SR), SR Ca2+ uptake and Na+ and K+ channel transport. Also targets transcription factors and signaling molecules to regulate heart function. In its activated form, is involved in the pathogenesis of dilated cardiomyopathy and heart failure. Contributes to cardiac decompensation and heart failure by regulating SR Ca2+ release via direct phosphorylation of RYR2 Ca2+ channel on S2808. In the nucleus, phosphorylates the MEF2 repressor HDAC4, promoting its nuclear export and binding to 14-3-3 protein, and expression of MEF2 and genes involved in the hypertrophic program. Is essential for left ventricular remodeling responses to myocardial infarction. In pathological myocardial remodeling acts downstream of the beta adrenergic receptor signaling cascade to regulate key proteins involved in ECC. Regulates Ca2+ influx to myocytes by binding and phosphorylating the L-type Ca2+ channel subunit beta-2 CACNB2. In addition to Ca2+ channels, can target and regulate the cardiac sarcolemmal Na+ channel SCN5A and the K+ channel Kv4.3, which contribute to arrhythmogenesis in heart failure. Phosphorylates phospholamban (PLB), an endogenous inhibitor of SERCA2A, contributing to the enhancement of SR Ca2+ uptake that may be important in frequency-dependent acceleration of relaxation (FDAR) and maintenance of contractile function during acidosis. May participate in the modulation of skeletal muscle function in response to exercise, by regulating SR Ca2+ transport through phosphorylation of PLB and TRDN, a ryanodine receptor-coupling factor. CAMK2 is composed of 4 different chains: alpha (CAMK2A), beta (CAMK2B), gamma (CAMK2G), and delta (CAMK2D). The different isoforms assemble into homo- or heteromultimeric holoenzymes composed of 12 subunits with two hexameric rings stacked one on top of the other. Interacts with RRAD and CACNB2. Ten isoforms of the human protein are produced by alternative splicing. Isoform Delta3, isoform Delta2, isoform Delta8 and isoform Delta9 are expressed in cardiac muscle. Isoform Delta11 is expressed in skeletal muscle. Activity is induced in skeletal muscle during exercise. The CAMK2 protein kinases contain a unique C-terminal subunit association domain responsible for oligomerization.

Protein type: EC 2.7.11.17; Kinase, protein; Protein kinase, CAMK; Protein kinase, Ser/Thr (non-receptor); CAMK group; CAMK2 family

Chromosomal Location of Human Ortholog: 4q26

Cellular Component: nucleoplasm; sarcoplasmic reticulum membrane; membrane; perinuclear region of cytoplasm; cytoplasm; plasma membrane; nucleus; cytosol; sarcolemma

Molecular Function: calmodulin binding; sodium channel inhibitor activity; protein serine/threonine kinase activity; protein binding; protein homodimerization activity; calmodulin-dependent protein kinase activity; titin binding; nitric-oxide synthase binding; ATP binding

Biological Process: positive regulation of smooth muscle cell proliferation; protein amino acid autophosphorylation; cytokine and chemokine mediated signaling pathway; peptidyl-threonine phosphorylation; positive regulation of smooth muscle cell migration; protein amino acid phosphorylation; cellular potassium ion homeostasis; regulation of heart contraction; protein oligomerization; regulation of transcription from RNA polymerase II promoter; positive regulation of Rac protein signal transduction; synaptic transmission; endoplasmic reticulum calcium ion homeostasis; peptidyl-serine phosphorylation; regulation of G2/M transition of mitotic cell cycle; response to hypoxia; regulation of cell growth; regulation of the force of heart contraction

Research Articles on CAMK2D

Similar Products

Product Notes

The CAMK2D camk2d (Catalog #AAA3223178) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CAMK2D Antibody - C-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CAMK2D can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the CAMK2D camk2d for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: YIRLTQYMDG SGMPKTMQSE ETRVWHRRDG KWQNVHFHRS GSPTVPIKPP. It is sometimes possible for the material contained within the vial of "CAMK2D, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.