Western Blot (WB)
(CACHD1 antibody (MBS5300387) used at 1 ug/ml to detect target protein.)
Rabbit CACHD1 Polyclonal Antibody | anti-CACHD1 antibody
CACHD1 antibody
Reactivity
Human, Mouse, Rat
Applications
Western Blot
Purity
Affinity purified
Synonyms
CACHD1; Polyclonal Antibody; CACHD1 antibody; Polyclonal CACHD1; Anti-CACHD1; Cache Domain Containing 1; KIAA1573; RP4-655E10.1; anti-CACHD1 antibody
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Specificity
CACHD1 antibody was raised against the N terminal of CACHD1
Purity/Purification
Affinity purified
Form/Format
Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CACHD1 antibody in PBS
Concentration
1 mg/ml (varies by lot)
Sequence Length
978
Applicable Applications for anti-CACHD1 antibody
Western Blot (WB)
Application Notes
WB: 1 ug/ml
Biological Significance
CACHD1 belongs to the calcium channel subunit alpha-2/delta family. It contains 2 cache domains and 1 VWFA domain. CACHD1 may regulate voltage-dependent calcium channels.
Cross-Reactivity
Human,Mouse,Rat
Immunogen
CACHD1 antibody was raised using the N terminal of CACHD1 corresponding to a region with amino acids HKFRCKGSYEHRSRPIYVSTVRPQSKHIVVILDHGASVTDTQLQIAKDAA
Preparation and Storage
Store at 2-8 degree C for short periods. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Western Blot (WB)
(CACHD1 antibody (MBS5300387) used at 1 ug/ml to detect target protein.)
Western Blot (WB)
(CACHD1 antibody (MBS5300387) used at 1 ug/ml to detect target protein.)
Related Product Information for anti-CACHD1 antibody
Rabbit polyclonal CACHD1 antibody raised against the N terminal of CACHD1
Product Categories/Family for anti-CACHD1 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
Molecular Weight
137 kDa (MW of target protein)
NCBI Official Full Name
CACHD1 protein
NCBI Official Synonym Full Names
cache domain containing 1
NCBI Official Symbol
CACHD1
NCBI Protein Information
VWFA and cache domain-containing protein 1
UniProt Protein Name
VWFA and cache domain-containing protein 1
Protein Family
UniProt Gene Name
CACHD1
UniProt Synonym Gene Names
KIAA1573; VWCD1; Cache domain-containing protein 1
UniProt Entry Name
CAHD1_HUMAN
Uniprot Description
CACHD1: May regulate voltage-dependent calcium channels. Belongs to the calcium channel subunit alpha-2/delta family. 2 isoforms of the human protein are produced by alternative splicing.
Protein type: Membrane protein, integral
Chromosomal Location of Human Ortholog: 1p31.3
Cellular Component: integral to membrane
Biological Process: calcium ion transport
Research Articles on CACHD1
Similar Products
Product Notes
The CACHD1 cachd1 (Catalog #AAA5300387) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CACHD1 antibody reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's CACHD1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1 ug/ml. Researchers should empirically determine the suitability of the CACHD1 cachd1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "CACHD1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
