Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Copine IV antibody (MBS839872) used at 1 ug/ml to detect target protein.)

Rabbit Copine IV Polyclonal Antibody | anti-CPNE4 antibody

Copine IV antibody

Gene Names
CPNE4; CPN4; COPN4
Applications
Western Blot
Purity
Affinity purified
Synonyms
Copine IV; Polyclonal Antibody; Copine IV antibody; Polyclonal Copine IV; Anti-Copine IV; CPNE4; COPN4; CPN4; Copine 4; MGC15604; anti-CPNE4 antibody
Ordering
For Research Use Only!
Host
Rabbit
Clonality
Polyclonal
Specificity
Copine IV antibody was raised against the N terminal of CPNE4
Purity/Purification
Affinity purified
Form/Format
Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CPNE4 antibody in PBS
Concentration
1 mg/ml (varies by lot)
Sequence Length
575
Applicable Applications for anti-CPNE4 antibody
Western Blot (WB)
Application Notes
WB: 1 ug/ml
Biological Significance
Calcium-dependent membrane-binding proteins may regulate molecular events at the interface of the cell membrane and cytoplasm. This gene is one of several genes that encode a calcium-dependent protein containing two N-terminal type II C2 domains and an integrin A domain-like sequence in the C-terminus. Calcium-dependent membrane-binding proteins may regulate molecular events at the interface of the cell membrane and cytoplasm.
Cross-Reactivity
Human, Mouse, Rat
Immunogen
Copine IV antibody was raised using the N terminal of CPNE4 corresponding to a region with amino acids EADFLGGMECTLGQIVSQRKLSKSLLKHGNTAGKSSITVIAEELSGNDDY
Preparation and Storage
Store at 2-8 degree C for short periods. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.

Western Blot (WB)

(Copine IV antibody (MBS839872) used at 1 ug/ml to detect target protein.)

Western Blot (WB) (Copine IV antibody (MBS839872) used at 1 ug/ml to detect target protein.)
Related Product Information for anti-CPNE4 antibody
Rabbit polyclonal Copine IV antibody raised against the N terminal of CPNE4
Product Categories/Family for anti-CPNE4 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
62 kDa (MW of target protein)
NCBI Official Full Name
copine-4 isoform 1
NCBI Official Synonym Full Names
copine IV
NCBI Official Symbol
CPNE4
NCBI Official Synonym Symbols
CPN4; COPN4
NCBI Protein Information
copine-4
UniProt Protein Name
Copine-4
Protein Family
UniProt Gene Name
CPNE4
UniProt Entry Name
CPNE4_HUMAN

NCBI Description

This gene belongs to the highly conserved copine family. It encodes a calcium-dependent, phospholipid-binding protein, which may be involved in membrane trafficking, mitogenesis and development. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jan 2014]

Uniprot Description

CPNE4: May function in membrane trafficking. Exhibits calcium- dependent phospholipid binding properties. Belongs to the copine family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Unknown function

Chromosomal Location of Human Ortholog: 3q22.1

Research Articles on CPNE4

Similar Products

Product Notes

The CPNE4 cpne4 (Catalog #AAA839872) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's Copine IV can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1 ug/ml. Researchers should empirically determine the suitability of the CPNE4 cpne4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "Copine IV, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.