Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of CABYR expression in transfected 293T cell line by CABYR polyclonal antibody. Lane 1: CABYR transfected lysate (41.1kD). Lane 2: Non-transfected lysate.)

Mouse anti-Human CABYR Polyclonal Antibody | anti-CABYR antibody

CABYR (Calcium-binding Tyrosine Phosphorylation-regulated Protein, Calcium-binding Protein 86, Cancer/Testis Antigen 88, CT88, Fibrousheathin II, Fibrousheathin-2, FSP-2, Testis-specific Calcium-binding Protein CBP86, CBP86, FSP2)

Gene Names
CABYR; CT88; FSP2; CBP86; FSP-2; CABYRa; CABYRc; CABYRe; CABYRc/d
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Purified by Protein A affinity chromatography.
Synonyms
CABYR; Polyclonal Antibody; CABYR (Calcium-binding Tyrosine Phosphorylation-regulated Protein; Calcium-binding Protein 86; Cancer/Testis Antigen 88; CT88; Fibrousheathin II; Fibrousheathin-2; FSP-2; Testis-specific Calcium-binding Protein CBP86; CBP86; FSP2); Anti -CABYR (Calcium-binding Tyrosine Phosphorylation-regulated Protein; anti-CABYR antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human CABYR.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
MISSKPRLVVPYGLKTLLEGISRAVLKTNPSNINQFAAAYFQELTMYRGNTTMDIKDLVKQFHQIKVEKWSEGTTPQKKLECLKEPGKTSVESKVPTQMEKSTDTDEDNVTRTEYSDKTTQFPSVYAVPGTEQTEAVGGLSSKPATPKTTTPPSSPPPTAVSPEFAYVPADPAQLAAQMLAMATSERGQPPPCSNMWTLYCLTDKNQQGHPSPPPAPGPFPQATLYLPNPKDPQFQQHPPKVTFPTYVMGDTKKTSAPPFILVGSNVQEAQGWKPLPGHAVVSQSDVLRYVAMQVPIAVPADEKYQKHTLSPQNANPPSGQDVPRPKSPVFLSVAFPVEDVAKKSSGSGDKCAPFGSYGIAGEVTVTTAHKRRKAETEN
Applicable Applications for anti-CABYR antibody
Western Blot (WB)
Application Notes
Suitable for use in Western Blot.
Immunogen
Full length human CABYR, aa1-379 (NP_619585.1).
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of CABYR expression in transfected 293T cell line by CABYR polyclonal antibody. Lane 1: CABYR transfected lysate (41.1kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of CABYR expression in transfected 293T cell line by CABYR polyclonal antibody. Lane 1: CABYR transfected lysate (41.1kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-CABYR antibody
May function as a regulator of both motility- and head-associated functions such as capacitation and the acrosome reaction. Isoform 1 binds calcium in vitro. Isoform 2 and isoform 6 probably bind calcium. Isoform 3 and isoform 5 do not bind calcium in vitro. Isoform 4 probably does not bind calcium.
Product Categories/Family for anti-CABYR antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
52,774 Da
NCBI Official Full Name
calcium-binding tyrosine phosphorylation-regulated protein isoform e
NCBI Official Synonym Full Names
calcium binding tyrosine-(Y)-phosphorylation regulated
NCBI Official Symbol
CABYR
NCBI Official Synonym Symbols
CT88; FSP2; CBP86; FSP-2; CABYRa; CABYRc; CABYRe; CABYRc/d
NCBI Protein Information
calcium-binding tyrosine phosphorylation-regulated protein; fibrousheathin 2; fibrousheathin-2; fibrousheathin II; cancer/testis antigen 88; calcium-binding protein 86; testis-specific calcium-binding protein CBP86; calcium binding tyrosine-(Y)-phosphorylation regulated (fibrousheathin 2); calcium-binding tyrosine-(Y)-phosphorylation regulated (fibrousheathin 2)
UniProt Protein Name
Calcium-binding tyrosine phosphorylation-regulated protein
UniProt Gene Name
CABYR
UniProt Synonym Gene Names
CBP86; FSP2; CT88; FSP-2
UniProt Entry Name
CABYR_HUMAN

NCBI Description

To reach fertilization competence, spermatozoa undergo a series of morphological and molecular maturational processes, termed capacitation, involving protein tyrosine phosphorylation and increased intracellular calcium. The protein encoded by this gene localizes to the principal piece of the sperm flagellum in association with the fibrous sheath and exhibits calcium-binding when phosphorylated during capacitation. A pseudogene on chromosome 3 has been identified for this gene. Alternatively spliced transcript variants encoding distinct protein isoforms have been found for this gene. [provided by RefSeq, Jul 2013]

Uniprot Description

CABYR: May function as a regulator of both motility- and head- associated functions such as capacitation and the acrosome reaction. Isoform 1 binds calcium in vitro. Isoform 2 and isoform 6 probably bind calcium. Isoform 3 and isoform 5 do not bind calcium in vitro. Isoform 4 probably does not bind calcium. 6 isoforms of the human protein are produced by alternative splicing.

Protein type: Calcium-binding; Cancer Testis Antigen (CTA)

Chromosomal Location of Human Ortholog: 18q11.2

Cellular Component: cytoskeleton; cytoplasm; nucleolus; nucleus

Molecular Function: enzyme binding; protein heterodimerization activity; calcium ion binding; SH3 domain binding

Biological Process: sperm capacitation

Research Articles on CABYR

Similar Products

Product Notes

The CABYR cabyr (Catalog #AAA6005367) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The CABYR (Calcium-binding Tyrosine Phosphorylation-regulated Protein, Calcium-binding Protein 86, Cancer/Testis Antigen 88, CT88, Fibrousheathin II, Fibrousheathin-2, FSP-2, Testis-specific Calcium-binding Protein CBP86, CBP86, FSP2) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CABYR can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Suitable for use in Western Blot. Researchers should empirically determine the suitability of the CABYR cabyr for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MISSKPRLVV PYGLKTLLEG ISRAVLKTNP SNINQFAAAY FQELTMYRGN TTMDIKDLVK QFHQIKVEKW SEGTTPQKKL ECLKEPGKTS VESKVPTQME KSTDTDEDNV TRTEYSDKTT QFPSVYAVPG TEQTEAVGGL SSKPATPKTT TPPSSPPPTA VSPEFAYVPA DPAQLAAQML AMATSERGQP PPCSNMWTLY CLTDKNQQGH PSPPPAPGPF PQATLYLPNP KDPQFQQHPP KVTFPTYVMG DTKKTSAPPF ILVGSNVQEA QGWKPLPGHA VVSQSDVLRY VAMQVPIAVP ADEKYQKHTL SPQNANPPSG QDVPRPKSPV FLSVAFPVED VAKKSSGSGD KCAPFGSYGI AGEVTVTTAH KRRKAETEN. It is sometimes possible for the material contained within the vial of "CABYR, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.