Western Blot (WB)
(C1ORF93 antibody (MBS5301173) used at 1 ug/ml to detect target protein.)
Rabbit C1ORF93 Polyclonal Antibody | anti-C1ORF93 antibody
C1ORF93 antibody
Gene Names
FAM213B; C1orf93
Applications
Western Blot
Purity
Affinity purified
Synonyms
C1ORF93; Polyclonal Antibody; C1ORF93 antibody; Polyclonal C1ORF93; Anti-C1ORF93; RP3-395M20.10; DKFZp547M123; Chromosome ORF 1; Chromosome ORF-1; MGC26818; Chromosome 1 ORF; anti-C1ORF93 antibody
Host
Rabbit
Clonality
Polyclonal
Specificity
C1ORF93 antibody was raised against the middle region of C1Orf93
Purity/Purification
Affinity purified
Form/Format
Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of C1ORF93 antibody in PBS
Concentration
1 mg/ml (varies by lot)
Sequence Length
183
Applicable Applications for anti-C1ORF93 antibody
Western Blot (WB)
Application Notes
WB: 1 ug/ml
Biological Significance
The function of Chromosome 1 ORF protein is not widely studied, and is yet to be elucidated fully.
Cross-Reactivity
Human
Immunogen
C1ORF93 antibody was raised using the middle region of C1Orf93 corresponding to a region with amino acids RYNSLSILPAALGKPVRDVAAKAKAVGIQGNLSGDLLQSGGLLVVSKGGD
Preparation and Storage
Store at 2-8 degree C for short periods. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Western Blot (WB)
(C1ORF93 antibody (MBS5301173) used at 1 ug/ml to detect target protein.)
Western Blot (WB)
(C1ORF93 antibody (MBS5301173) used at 1 ug/ml to detect target protein.)
Related Product Information for anti-C1ORF93 antibody
Rabbit polyclonal C1ORF93 antibody raised against the middle region of C1Orf93
Product Categories/Family for anti-C1ORF93 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
Molecular Weight
21 kDa (MW of target protein)
NCBI Official Full Name
chromosome 1 open reading frame 93, isoform CRA_f
NCBI Official Synonym Full Names
family with sequence similarity 213, member B
NCBI Official Symbol
FAM213B
NCBI Official Synonym Symbols
C1orf93
NCBI Protein Information
prostamide/prostaglandin F synthase
UniProt Protein Name
Prostamide/prostaglandin F synthase
UniProt Gene Name
FAM213B
UniProt Synonym Gene Names
C1orf93; Prostamide/PG F synthase; Prostamide/PGF synthase
UniProt Entry Name
PGFS_HUMAN
Uniprot Description
FAM213B: Catalyzes the reduction of prostaglandin-ethanolamide H(2) (prostamide H(2)) to prostamide F(2alpha) with NADPH as proton donor. Also able to reduce prostaglandin H(2) to prostaglandin F(2alpha). Belongs to the peroxiredoxin-like FAM213 family. prostamide/prostaglandin F synthase subfamily. 7 isoforms of the human protein are produced by alternative splicing.
Protein type: EC 1.11.1.20
Chromosomal Location of Human Ortholog: 1p36.32
Cellular Component: endoplasmic reticulum; cytoplasm; cytosol; myelin sheath
Molecular Function: prostaglandin-F synthase activity; oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor
Biological Process: cyclooxygenase pathway; arachidonic acid metabolic process; prostaglandin biosynthetic process
Similar Products
Product Notes
The C1ORF93 fam213b (Catalog #AAA5301173) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's C1ORF93 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1 ug/ml. Researchers should empirically determine the suitability of the C1ORF93 fam213b for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "C1ORF93, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
