Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (C9ORF4 antibody (MBS5300115) used at 1 ug/ml to detect target protein.)

Rabbit C9ORF4 Polyclonal Antibody | anti-C9ORF4 antibody

C9ORF4 antibody

Gene Names
FRRS1L; CG6; CG-6; C9orf4
Applications
Western Blot
Purity
Affinity purified
Synonyms
C9ORF4; Polyclonal Antibody; C9ORF4 antibody; Polyclonal C9ORF4; Anti-C9ORF4; CG6; Chromosome ORF 9; Chromosome ORF-9; CG-6; Chromosome 9 ORF; anti-C9ORF4 antibody
Ordering
For Research Use Only!
Host
Rabbit
Clonality
Polyclonal
Specificity
C9ORF4 antibody was raised against the middle region of C9Orf4
Purity/Purification
Affinity purified
Form/Format
Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of C9ORF4 antibody in PBS
Concentration
1 mg/ml (varies by lot)
Sequence Length
344
Applicable Applications for anti-C9ORF4 antibody
Western Blot (WB)
Application Notes
WB: 1 ug/ml
Biological Significance
The function of C9orf4 protein has not been widely studied, and is yet to be fully elucidated.
Cross-Reactivity
Human, Rat
Immunogen
C9ORF4 antibody was raised using the middle region of C9Orf4 corresponding to a region with amino acids HDDNGRVRIQHFYNVGQWAKEIQRNPARDEEGVFENNRVTCRFKRPVNVP
Preparation and Storage
Store at 2-8 degree C for short periods. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.

Western Blot (WB)

(C9ORF4 antibody (MBS5300115) used at 1 ug/ml to detect target protein.)

Western Blot (WB) (C9ORF4 antibody (MBS5300115) used at 1 ug/ml to detect target protein.)
Related Product Information for anti-C9ORF4 antibody
Rabbit polyclonal C9ORF4 antibody raised against the middle region of C9Orf4
Product Categories/Family for anti-C9ORF4 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
Molecular Weight
37 kDa (MW of target protein)
NCBI Official Full Name
chromosome 9 open reading frame 4
NCBI Official Synonym Full Names
ferric-chelate reductase 1-like
NCBI Official Symbol
FRRS1L
NCBI Official Synonym Symbols
CG6; CG-6; C9orf4
NCBI Protein Information
DOMON domain-containing protein FRRS1L
UniProt Protein Name
DOMON domain-containing protein FRRS1L
UniProt Gene Name
FRRS1L
UniProt Synonym Gene Names
C9orf4
UniProt Entry Name
FRS1L_HUMAN

Uniprot Description

FRRS1L: Component of the outer core of AMPAR complex. AMPAR complex consists of an inner core made of 4 pore-forming GluA/GRIA proteins (GRIA1, GRIA2, GRIA3 and GRIA4) and 4 major auxiliary subunits arranged in a twofold symmetry. One of the two pairs of distinct binding sites is occupied either by CNIH2, CNIH3 or CACNG2, CACNG3. The other harbors CACNG2, CACNG3, CACNG4, CACNG8 or GSG1L. This inner core of AMPAR complex is complemented by outer core constituents binding directly to the GluA/GRIA proteins at sites distinct from the interaction sites of the inner core constituents. Outer core constituents include at least PRRT1, PRRT2, CKAMP44/SHISA9, FRRS1L and NRN1. The proteins of the inner and outer core serve as a platform for other, more peripherally associated AMPAR constituents. Alone or in combination, these auxiliary subunits control the gating and pharmacology of the AMPAR complex and profoundly impact their biogenesis and protein processing

Protein type: Membrane protein, integral; Oxidoreductase

Chromosomal Location of Human Ortholog: 9q31

Cellular Component: plasma membrane; integral to membrane; synapse; cell junction

Similar Products

Product Notes

The C9ORF4 frrs1l (Catalog #AAA5300115) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's C9ORF4 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1 ug/ml. Researchers should empirically determine the suitability of the C9ORF4 frrs1l for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "C9ORF4, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.