Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (C1ORF190 antibody (MBS839758) used at 1 ug/ml to detect target protein.)

Rabbit C1ORF190 Polyclonal Antibody | anti-C1ORF190 antibody

C1ORF190 antibody

Gene Names
LURAP1; LRP35A; LRAP35a; C1orf190
Applications
Western Blot
Purity
Affinity purified
Synonyms
C1ORF190; Polyclonal Antibody; C1ORF190 antibody; Polyclonal C1ORF190; Anti-C1ORF190; Chromosome 1 ORF; Chromosome ORF-1; Chromosome ORF 1; FLJ25163; anti-C1ORF190 antibody
Ordering
For Research Use Only!
Host
Rabbit
Clonality
Polyclonal
Specificity
C1ORF190 antibody was raised against the middle region of C1Orf190
Purity/Purification
Affinity purified
Form/Format
Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of C1ORF190 antibody in PBS
Concentration
1 mg/ml (varies by lot)
Sequence Length
239
Applicable Applications for anti-C1ORF190 antibody
Western Blot (WB)
Application Notes
WB: 1 ug/ml
Biological Significance
The function of Chromosome 1 ORF protein is not widely studied, and is yet to be elucidated fully.
Cross-Reactivity
Human
Immunogen
C1ORF190 antibody was raised using the middle region of C1Orf190 corresponding to a region with amino acids SIGSFLDTVAPSELDEQGPPGAPRSEMDWAKVIAGGERARTEVDVAATRL
Preparation and Storage
Store at 2-8 degree C for short periods. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.

Western Blot (WB)

(C1ORF190 antibody (MBS839758) used at 1 ug/ml to detect target protein.)

Western Blot (WB) (C1ORF190 antibody (MBS839758) used at 1 ug/ml to detect target protein.)
Related Product Information for anti-C1ORF190 antibody
Rabbit polyclonal C1ORF190 antibody raised against the middle region of C1Orf190
Product Categories/Family for anti-C1ORF190 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
Molecular Weight
26 kDa (MW of target protein)
NCBI Official Full Name
chromosome 1 open reading frame 190
NCBI Official Synonym Full Names
leucine rich adaptor protein 1
NCBI Official Symbol
LURAP1
NCBI Official Synonym Symbols
LRP35A; LRAP35a; C1orf190
NCBI Protein Information
leucine rich adaptor protein 1
UniProt Protein Name
Leucine rich adaptor protein 1
UniProt Gene Name
LURAP1
UniProt Synonym Gene Names
C1orf190; LRAP35A; LRP35A
UniProt Entry Name
LURA1_HUMAN

Uniprot Description

1520402A15Rik: Acts as an activator of the canonical NF-kappa-B pathway and drive the production of proinflammatory cytokines. Promotes the antigen (Ag)-presenting and priming function of dendritic cells via the canonical NF-kappa-B pathway. In concert with MYO18A and CDC42BPA/CDC42BPB, is involved in modulating lamellar actomyosin retrograde flow that is crucial to cell protrusion and migration. Activates CDC42BPA/CDC42BPB and targets it to actomyosin through its interaction with MYO18A, leading to MYL9/MLC2 phosphorylation and MYH9/MYH10-dependent actomyosin assembly in the lamella.

Protein type: Contractile; Motility/polarity/chemotaxis

Chromosomal Location of Human Ortholog: 1p34

Cellular Component: cytoplasm; actomyosin

Biological Process: positive regulation of cytokine production; cell migration; positive regulation of I-kappaB kinase/NF-kappaB cascade; actomyosin structure organization and biogenesis

Research Articles on C1ORF190

Similar Products

Product Notes

The C1ORF190 lurap1 (Catalog #AAA839758) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's C1ORF190 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1 ug/ml. Researchers should empirically determine the suitability of the C1ORF190 lurap1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "C1ORF190, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.