Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (C16ORF48 antibody (MBS5300319) used at 1 ug/ml to detect target protein.)

Rabbit C16ORF48 Polyclonal Antibody | anti-C16ORF48 antibody

C16ORF48 antibody

Gene Names
ENKD1; C16orf48; DAKV6410
Applications
Western Blot
Purity
Affinity purified
Synonyms
C16ORF48; Polyclonal Antibody; C16ORF48 antibody; Polyclonal C16ORF48; Anti-C16ORF48; Chromosome ORF-16; Chromosome ORF 16; DAKV6410; Chromosome 16 ORF; DKFZP434A1319; anti-C16ORF48 antibody
Ordering
For Research Use Only!
Host
Rabbit
Clonality
Polyclonal
Specificity
C16ORF48 antibody was raised against the middle region of C16Orf48
Purity/Purification
Affinity purified
Form/Format
Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of C16ORF48 antibody in PBS
Concentration
1 mg/ml (varies by lot)
Sequence Length
346
Applicable Applications for anti-C16ORF48 antibody
Western Blot (WB)
Application Notes
WB: 1 ug/ml
Biological Significance
The function of C16orf48 protein has not been widely studied, and is yet to be fully elucidated.
Cross-Reactivity
Human
Immunogen
C16ORF48 antibody was raised using the middle region of C16Orf48 corresponding to a region with amino acids RHSCSLQVLAQVLEQQRQAQEHYNATQKGHVPHYLLERRDLWRREAEARK
Preparation and Storage
Store at 2-8 degree C for short periods. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.

Western Blot (WB)

(C16ORF48 antibody (MBS5300319) used at 1 ug/ml to detect target protein.)

Western Blot (WB) (C16ORF48 antibody (MBS5300319) used at 1 ug/ml to detect target protein.)
Related Product Information for anti-C16ORF48 antibody
Rabbit polyclonal C16ORF48 antibody raised against the middle region of C16Orf48
Product Categories/Family for anti-C16ORF48 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
Molecular Weight
39 kDa (MW of target protein)
NCBI Official Full Name
Chromosome 16 open reading frame 48
NCBI Official Synonym Full Names
enkurin domain containing 1
NCBI Official Symbol
ENKD1
NCBI Official Synonym Symbols
C16orf48; DAKV6410
NCBI Protein Information
enkurin domain-containing protein 1
UniProt Protein Name
Enkurin domain-containing protein 1
UniProt Gene Name
ENKD1
UniProt Synonym Gene Names
C16orf48
UniProt Entry Name
ENKD1_HUMAN

Uniprot Description

ENKD1: 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Cytoskeletal

Chromosomal Location of Human Ortholog: 16q22.1

Cellular Component: microtubule cytoskeleton; cytoplasmic microtubule

Similar Products

Product Notes

The C16ORF48 enkd1 (Catalog #AAA5300319) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's C16ORF48 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1 ug/ml. Researchers should empirically determine the suitability of the C16ORF48 enkd1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "C16ORF48, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.