Western Blot (WB)
(C9ORF46 antibody (MBS839056) used at 1 ug/ml to detect target protein.)
Rabbit C9ORF46 Polyclonal Antibody | anti-C9ORF46 antibody
C9ORF46 antibody
Gene Names
PLGRKT; AD025; MDS030; C9orf46; PLG-RKT; Plg-R(KT)
Applications
Western Blot
Purity
Affinity purified
Synonyms
C9ORF46; Polyclonal Antibody; C9ORF46 antibody; Polyclonal C9ORF46; Anti-C9ORF46; AD025; FLJ39176; MDS030; Chromosome ORF 9; FLJ14688; Chromosome 9 ORF; Chromosome ORF-9; anti-C9ORF46 antibody
Host
Rabbit
Clonality
Polyclonal
Specificity
C9ORF46 antibody was raised against the middle region of C9Orf46
Purity/Purification
Affinity purified
Form/Format
Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of C9ORF46 antibody in PBS
Concentration
1 mg/ml (varies by lot)
Sequence Length
74
Applicable Applications for anti-C9ORF46 antibody
Western Blot (WB)
Application Notes
WB: 1 ug/ml
Biological Significance
The function of C9orf46 protein has not been widely studied, and is yet to be fully elucidated.
Cross-Reactivity
Human
Immunogen
C9ORF46 antibody was raised using the middle region of C9Orf46 corresponding to a region with amino acids AIKKKKPAFLVPIVPLSFILTYQYDLGYGTLLERMKGEAEDILETEKSKL
Preparation and Storage
Store at 2-8 degree C for short periods. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Western Blot (WB)
(C9ORF46 antibody (MBS839056) used at 1 ug/ml to detect target protein.)
Western Blot (WB)
(C9ORF46 antibody (MBS839056) used at 1 ug/ml to detect target protein.)
Related Product Information for anti-C9ORF46 antibody
Rabbit polyclonal C9ORF46 antibody raised against the middle region of C9Orf46
Product Categories/Family for anti-C9ORF46 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
Molecular Weight
17 kDa (MW of target protein)
NCBI Official Full Name
chromosome 9 open reading frame 46, isoform CRA_c, partial
NCBI Official Synonym Full Names
plasminogen receptor, C-terminal lysine transmembrane protein
NCBI Official Symbol
PLGRKT
NCBI Official Synonym Symbols
AD025; MDS030; C9orf46; PLG-RKT; Plg-R(KT)
NCBI Protein Information
plasminogen receptor (KT)
UniProt Protein Name
Plasminogen receptor (KT)
UniProt Gene Name
PLGRKT
UniProt Synonym Gene Names
C9orf46; Plg-R(KT)
UniProt Entry Name
PLRKT_HUMAN
Uniprot Description
PLGRKT: Receptor for plasminogen. Regulates urokinase plasminogen activator-dependent and stimulates tissue-type plasminogen activator-dependent cell surface plasminogen activation. Proposed to be part of a local catecholaminergic cell plasminogen activation system that regulates neuroendocrine prohormone processing. Involved in regulation of inflammatory response; regulates monocyte chemotactic migration and matrix metallproteinase activation, such as of MMP2 and MMP9.
Protein type: Membrane protein, integral; Membrane protein, multi-pass
Chromosomal Location of Human Ortholog: 9p24.1
Cellular Component: mitochondrion; integral to plasma membrane
Biological Process: inflammatory response; chemotaxis
Research Articles on C9ORF46
Similar Products
Product Notes
The C9ORF46 plgrkt (Catalog #AAA839056) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's C9ORF46 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1 ug/ml. Researchers should empirically determine the suitability of the C9ORF46 plgrkt for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "C9ORF46, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
