Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (IFI16 monoclonal antibody (M05), clone 1B4 Western Blot analysis of IFI16 expression in Hela S3 NE (Cat # L013V3).)

Mouse IFI16 Monoclonal Antibody | anti-IFI16 antibody

IFI16 (Interferon, gamma-Inducible Protein 16, IFNGIP1, MGC9466, PYHIN2) (PE)

Gene Names
IFI16; PYHIN2; IFNGIP1
Applications
Immunohistochemistry, Western Blot
Purity
Purified
Synonyms
IFI16; Monoclonal Antibody; IFI16 (Interferon; gamma-Inducible Protein 16; IFNGIP1; MGC9466; PYHIN2) (PE); Interferon; PYHIN2; anti-IFI16 antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
1B4
Specificity
Recognizes IFI16.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Sequence Length
729
Applicable Applications for anti-IFI16 antibody
Immunohistochemistry (IHC), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
IFI16 (AAH17059, 630aa-729aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
FVNGVFEVHKKNVRGEFTYYEIQDNTGKMEVVVHGRLTTINCEEGDKLKLTCFELAPKSGNTGELRSVIHSHIKVIKTRKNKKDILNPDSSMETSPDFFF
Conjugate
PE
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(IFI16 monoclonal antibody (M05), clone 1B4 Western Blot analysis of IFI16 expression in Hela S3 NE (Cat # L013V3).)

Western Blot (WB) (IFI16 monoclonal antibody (M05), clone 1B4 Western Blot analysis of IFI16 expression in Hela S3 NE (Cat # L013V3).)

Testing Data

(Detection limit for recombinant GST tagged IFI16 is approximately 0.1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged IFI16 is approximately 0.1ng/ml as a capture antibody.)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to IFI16 on formalin-fixed paraffin-embedded human prostate. [antibody concentration 0.5 ug/ml])

Immunohistochemistry (IHC) (Immunoperoxidase of monoclonal antibody to IFI16 on formalin-fixed paraffin-embedded human prostate. [antibody concentration 0.5 ug/ml])

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to IFI16 on formalin-fixed paraffin-embedded human prostate. [antibody concentration 0.5 ug/ml])

Immunohistochemistry (IHC) (Immunoperoxidase of monoclonal antibody to IFI16 on formalin-fixed paraffin-embedded human prostate. [antibody concentration 0.5 ug/ml])
Related Product Information for anti-IFI16 antibody
This gene encodes a member of the HIN-200 (hematopoietic interferon-inducible nuclear antigens with 200 amino acid repeats) family of cytokines. The encoded protein contains domains involved in DNA binding, transcriptional regulation, and protein-protein interactions. The protein localizes to the nucleoplasm and nucleoli, and interacts with p53 and retinoblastoma-1. It modulates p53 function, and inhibits cell growth in the Ras/Raf signaling pathway. [provided by RefSeq]
Product Categories/Family for anti-IFI16 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Official Full Name
Interferon, gamma-inducible protein 16
NCBI Official Synonym Full Names
interferon gamma inducible protein 16
NCBI Official Symbol
IFI16
NCBI Official Synonym Symbols
PYHIN2; IFNGIP1
NCBI Protein Information
gamma-interferon-inducible protein 16

NCBI Description

This gene encodes a member of the HIN-200 (hematopoietic interferon-inducible nuclear antigens with 200 amino acid repeats) family of cytokines. The encoded protein contains domains involved in DNA binding, transcriptional regulation, and protein-protein interactions. The protein localizes to the nucleoplasm and nucleoli, and interacts with p53 and retinoblastoma-1. It modulates p53 function, and inhibits cell growth in the Ras/Raf signaling pathway. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Apr 2011]

Research Articles on IFI16

Similar Products

Product Notes

The IFI16 (Catalog #AAA6184427) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's IFI16 can be used in a range of immunoassay formats including, but not limited to, Immunohistochemistry (IHC), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the IFI16 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "IFI16, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.