Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: BUB1BSample Tissue: Human Lung Tumor lysatesAntibody Dilution: 1ug/ml)

Rabbit anti-Human BUB1B Polyclonal Antibody | anti-BUB1B antibody

BUB1B Antibody - N-terminal region

Gene Names
BUB1B; MVA1; SSK1; BUBR1; Bub1A; MAD3L; hBUBR1; BUB1beta
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
BUB1B; Polyclonal Antibody; BUB1B Antibody - N-terminal region; anti-BUB1B antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: AFEYEIRFYTGNDPLDVWDRYISWTEQNYPQGGKESNMSTLLERAVEALQ
Sequence Length
933
Applicable Applications for anti-BUB1B antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human BUB1B
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: BUB1BSample Tissue: Human Lung Tumor lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: BUB1BSample Tissue: Human Lung Tumor lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-BUB1B antibody
This gene encodes a kinase involved in spindle checkpoint function. The protein has been localized to the kinetochore and plays a role in the inhibition of the anaphase-promoting complex/cyclosome (APC/C), delaying the onset of anaphase and ensuring proper chromosome segregation. Impaired spindle checkpoint function has been found in many forms of cancer.
Product Categories/Family for anti-BUB1B antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
701
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
102 kDa
NCBI Official Full Name
mitotic checkpoint serine/threonine-protein kinase BUB1 beta
NCBI Official Synonym Full Names
BUB1 mitotic checkpoint serine/threonine kinase B
NCBI Official Symbol
BUB1B
NCBI Official Synonym Symbols
MVA1; SSK1; BUBR1; Bub1A; MAD3L; hBUBR1; BUB1beta
NCBI Protein Information
mitotic checkpoint serine/threonine-protein kinase BUB1 beta
UniProt Protein Name
Mitotic checkpoint serine/threonine-protein kinase BUB1 beta
UniProt Gene Name
BUB1B
UniProt Synonym Gene Names
BUBR1; MAD3L; SSK1; hBUBR1
UniProt Entry Name
BUB1B_HUMAN

NCBI Description

This gene encodes a kinase involved in spindle checkpoint function. The protein has been localized to the kinetochore and plays a role in the inhibition of the anaphase-promoting complex/cyclosome (APC/C), delaying the onset of anaphase and ensuring proper chromosome segregation. Impaired spindle checkpoint function has been found in many forms of cancer. [provided by RefSeq, Jul 2008]

Uniprot Description

BUB1B: Essential component of the mitotic checkpoint. Required for normal mitosis progression. The mitotic checkpoint delays anaphase until all chromosomes are properly attached to the mitotic spindle. One of its checkpoint functions is to inhibit the activity of the anaphase-promoting complex/cyclosome (APC/C) by blocking the binding of CDC20 to APC/C, independently of its kinase activity. The other is to monitor kinetochore activities that depend on the kinetochore motor CENPE. Required for kinetochore localization of CENPE. Negatively regulates PLK1 activity in interphase cells and suppresses centrosome amplification. Also implicated in triggering apoptosis in polyploid cells that exit aberrantly from mitotic arrest. May play a role for tumor suppression. Interacts with CENPE, CENPF, mitosin, PLK1 and BUB3. Part of a complex containing BUB3, CDC20 and BUB1B. Interacts with anaphase-promoting complex/cyclosome (APC/C). Interacts with CASC5. Induced during mitosis. Highly expressed in thymus followed by spleen. Preferentially expressed in tissues with a high mitotic index. Kinase activity stimulated by CENPE. Belongs to the protein kinase superfamily. Ser/Thr protein kinase family. BUB1 subfamily. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Tumor suppressor; EC 2.7.11.1; Protein kinase, Other; Protein kinase, Ser/Thr (non-receptor); Kinase, protein; Other group; BUB family

Chromosomal Location of Human Ortholog: 15q15

Cellular Component: kinetochore; anaphase-promoting complex; perinuclear region of cytoplasm; cytoplasm; microtubule organizing center; outer kinetochore of condensed chromosome; spindle midzone; cytosol

Molecular Function: protein serine/threonine kinase activity; protein binding; ATP binding; protein kinase activity

Biological Process: cell proliferation; mitosis; negative regulation of ubiquitin-protein ligase activity during mitotic cell cycle; regulation of ubiquitin-protein ligase activity during mitotic cell cycle; cell division; apoptosis; anaphase-promoting complex-dependent proteasomal ubiquitin-dependent protein catabolic process; mitotic cell cycle checkpoint; mitotic cell cycle spindle assembly checkpoint; mitotic cell cycle; protein amino acid phosphorylation; mitotic metaphase/anaphase transition

Disease: Mosaic Variegated Aneuploidy Syndrome 1; Premature Chromatid Separation Trait

Research Articles on BUB1B

Similar Products

Product Notes

The BUB1B bub1b (Catalog #AAA3221641) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The BUB1B Antibody - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's BUB1B can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the BUB1B bub1b for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: AFEYEIRFYT GNDPLDVWDR YISWTEQNYP QGGKESNMST LLERAVEALQ. It is sometimes possible for the material contained within the vial of "BUB1B, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.