Western Blot (WB)
(WB Suggested Anti-BTNL8 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: HT1080 cell lysate)
Rabbit anti-Human BTNL8 Polyclonal Antibody | anti-BTNL8 antibody
BTNL8 antibody - middle region
Gene Names
BTNL8; BTN9.2
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
BTNL8; Polyclonal Antibody; BTNL8 antibody - middle region; anti-BTNL8 antibody
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: PRPTAKWKGPQGQDLSTDSRTNRDMHGLFDVEISLTVQENAGSISCSMRH
Sequence Length
347
Applicable Applications for anti-BTNL8 antibody
Western Blot (WB)
Homology
Human: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human BTNL8
Conjugation
Unconjugated
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(WB Suggested Anti-BTNL8 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: HT1080 cell lysate)
Western Blot (WB)
(WB Suggested Anti-BTNL8 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: HT1080 cell lysate)
Related Product Information for anti-BTNL8 antibody
This is a rabbit polyclonal antibody against BTNL8. It was validated on Western Blot
Target Description: BTNL8 is a single-pass type I membrane protein. It belongs to the immunoglobulin superfamily, BTN/MOG family. BTNL8 contains 1 B30.2/SPRY domain and 1 Ig-like V-type domain. The exact function of BTNL8 remains unknown.
Target Description: BTNL8 is a single-pass type I membrane protein. It belongs to the immunoglobulin superfamily, BTN/MOG family. BTNL8 contains 1 B30.2/SPRY domain and 1 Ig-like V-type domain. The exact function of BTNL8 remains unknown.
Product Categories/Family for anti-BTNL8 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
38kDa
NCBI Official Full Name
butyrophilin-like protein 8 isoform 1
NCBI Official Synonym Full Names
butyrophilin like 8
NCBI Official Symbol
BTNL8
NCBI Official Synonym Symbols
BTN9.2
NCBI Protein Information
butyrophilin-like protein 8
UniProt Protein Name
Butyrophilin-like protein 8
Protein Family
UniProt Gene Name
BTNL8
UniProt Synonym Gene Names
UNQ702/PRO1347
UniProt Entry Name
BTNL8_HUMAN
Uniprot Description
BTNL8: Belongs to the immunoglobulin superfamily. BTN/MOG family. 2 isoforms of the human protein are produced by alternative splicing.
Protein type: Membrane protein, integral
Chromosomal Location of Human Ortholog: 5q35.3
Cellular Component: integral to membrane
Molecular Function: protein binding
Biological Process: immune system process
Research Articles on BTNL8
Similar Products
Product Notes
The BTNL8 btnl8 (Catalog #AAA3209688) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The BTNL8 antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's BTNL8 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the BTNL8 btnl8 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: PRPTAKWKGP QGQDLSTDSR TNRDMHGLFD VEISLTVQEN AGSISCSMRH. It is sometimes possible for the material contained within the vial of "BTNL8, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
