<
Immunohistochemistry (IHC)
(Rabbit Anti-AREL1 AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Pineal TissueObserved Staining: Cytoplasmic in vesicles in cell bodies of pinealocytesPrimary Antibody Concentration: 1:100Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)
Rabbit KIAA0317 Polyclonal Antibody | anti-AREL1 antibody
KIAA0317 antibody - N-terminal region
Gene Names
AREL1; FIEL1; KIAA0317
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Immunohistochemistry, Western Blot
Purity
Affinity Purified
Synonyms
KIAA0317; Polyclonal Antibody; KIAA0317 antibody - N-terminal region; anti-AREL1 antibody
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: LTCGQPHTLQIVPRDEYDNPTNNSMSLRDEHNYTLSIHELGPQEEESTGV
Sequence Length
823
Applicable Applications for anti-AREL1 antibody
Immunohistochemistry (IHC), Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 85%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human KIAA0317
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Immunohistochemistry (IHC)
(Rabbit Anti-AREL1 AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Pineal TissueObserved Staining: Cytoplasmic in vesicles in cell bodies of pinealocytesPrimary Antibody Concentration: 1:100Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)
Immunohistochemistry (IHC)
(Rabbit Anti-AREL1 AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Pineal TissueObserved Staining: Cytoplasmic in vesicles in cell bodies of pinealocytesPrimary Antibody Concentration: 1:100Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)
Immunohistochemistry (IHC)
(Rabbit Anti-KIAA0317 antibodyFormalin Fixed Paraffin Embedded Tissue: Human Lung, Respiratory EpitheliumPrimary antibody Concentration: 1:100Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20xExposure Time: 0.5-2.0sec)
Immunohistochemistry (IHC)
(Rabbit Anti-KIAA0317 antibodyFormalin Fixed Paraffin Embedded Tissue: Human Lung, Respiratory EpitheliumPrimary antibody Concentration: 1:100Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20xExposure Time: 0.5-2.0sec)
Immunohistochemistry (IHC)
(Rabbit Anti-KIAA0317 antibodyFormalin Fixed Paraffin Embedded Tissue: Human TonsilPrimary antibody Concentration: 1:100Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20xExposure Time: 0.5-2.0sec)
Immunohistochemistry (IHC)
(Rabbit Anti-KIAA0317 antibodyFormalin Fixed Paraffin Embedded Tissue: Human TonsilPrimary antibody Concentration: 1:100Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20xExposure Time: 0.5-2.0sec)
Western Blot (WB)
(WB Suggested Anti-KIAA0317 Antibody Titration: 0.2-1 ug/mlPositive Control: HT1080 cell lysateAREL1 is supported by BioGPS gene expression data to be expressed in HT1080)
Western Blot (WB)
(WB Suggested Anti-KIAA0317 Antibody Titration: 0.2-1 ug/mlPositive Control: HT1080 cell lysateAREL1 is supported by BioGPS gene expression data to be expressed in HT1080)
Related Product Information for anti-AREL1 antibody
This is a rabbit polyclonal antibody against KIAA0317. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: KIAA0317 contains 1 filamin repeat and 1 HECT (E6AP-type E3 ubiquitin-protein ligase) domain. The exact function of KIAA0317 remains unknown.
Target Description: KIAA0317 contains 1 filamin repeat and 1 HECT (E6AP-type E3 ubiquitin-protein ligase) domain. The exact function of KIAA0317 remains unknown.
Product Categories/Family for anti-AREL1 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
94kDa
NCBI Official Full Name
apoptosis-resistant E3 ubiquitin protein ligase 1
NCBI Official Synonym Full Names
apoptosis resistant E3 ubiquitin protein ligase 1
NCBI Official Symbol
AREL1
NCBI Official Synonym Symbols
FIEL1; KIAA0317
NCBI Protein Information
apoptosis-resistant E3 ubiquitin protein ligase 1
UniProt Protein Name
Apoptosis-resistant E3 ubiquitin protein ligase 1
Protein Family
UniProt Gene Name
AREL1
UniProt Synonym Gene Names
KIAA0317
UniProt Entry Name
AREL1_HUMAN
Research Articles on AREL1
Similar Products
Product Notes
The AREL1 arel1 (Catalog #AAA3207571) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The KIAA0317 antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's KIAA0317 can be used in a range of immunoassay formats including, but not limited to, Immunohistochemistry (IHC), Western Blot (WB). Researchers should empirically determine the suitability of the AREL1 arel1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: LTCGQPHTLQ IVPRDEYDNP TNNSMSLRDE HNYTLSIHEL GPQEEESTGV. It is sometimes possible for the material contained within the vial of "KIAA0317, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
