Western Blot (WB)
(Host: RabbitTarget Name: BRSK2Sample Tissue: Human HCT116 Whole Cell lysatesAntibody Dilution: 1ug/ml)
Rabbit anti-Human BRSK2 Polyclonal Antibody | anti-BRSK2 antibody
BRSK2 Antibody - middle region
Gene Names
BRSK2; SAD1; SADA; STK29; PEN11B; C11orf7
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
BRSK2; Polyclonal Antibody; BRSK2 Antibody - middle region; anti-BRSK2 antibody
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: CFRDRNKLLQDLLSEEENQEKMIYFLLLDRKERYPSQEDEDLPPRNEIDP
Sequence Length
614
Applicable Applications for anti-BRSK2 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human BRSK2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(Host: RabbitTarget Name: BRSK2Sample Tissue: Human HCT116 Whole Cell lysatesAntibody Dilution: 1ug/ml)
Western Blot (WB)
(Host: RabbitTarget Name: BRSK2Sample Tissue: Human HCT116 Whole Cell lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-BRSK2 antibody
Serine/threonine-protein kinase that plays a key role in polarization of neurons and axonogenesis, cell cycle progress and insulin secretion. Phosphorylates CDK16, CDC25C, MAPT/TAU, PAK1 and WEE1. Following phosphorylation and activation by STK11/LKB1, acts as a key regulator of polarization of cortical neurons, probably by mediating phosphorylation of microtubule-associated proteins such as MAPT/TAU at 'Thr-529' and 'Ser-579'. Also regulates neuron polarization by mediating phosphorylation of WEE1 at 'Ser-642' in postmitotic neurons, leading to down-regulate WEE1 activity in polarized neurons. Plays a role in the regulation of the mitotic cell cycle progress and the onset of mitosis. Plays a role in the regulation of insulin secretion in response to elevated glucose levels, probably via phosphorylation of CDK16 and PAK1. While BRSK2 phosphorylated at Thr-174 can inhibit insulin secretion, BRSK2 phosphorylated at Thr-260 can promote insulin secretion. Regulates reorganization of the actin cytoskeleton. May play a role in the apoptotic response triggered by endoplasmatic reticulum (ER) stress.
Product Categories/Family for anti-BRSK2 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
67 kDa
NCBI Official Full Name
Serine/threonine-protein kinase BRSK2
NCBI Official Synonym Full Names
BR serine/threonine kinase 2
NCBI Official Symbol
BRSK2
NCBI Official Synonym Symbols
SAD1; SADA; STK29; PEN11B; C11orf7
NCBI Protein Information
serine/threonine-protein kinase BRSK2
UniProt Protein Name
Serine/threonine-protein kinase BRSK2
Protein Family
UniProt Gene Name
BRSK2
UniProt Synonym Gene Names
C11orf7; PEN11B; SADA; STK29; BR serine/threonine-protein kinase 2
UniProt Entry Name
BRSK2_HUMAN
Uniprot Description
BRSK2: a serine/threonine protein kinase of the CAMK group. Closely related to AMPK. Activated by the kinase LKB1. BRSK1 and BRSK2 are required for nueronal polarization. Expressed in the brain and at low levels in the testis. Four alternatively spliced isoforms have been described.
Protein type: EC 2.7.11.1; EC 2.7.11.26; Protein kinase, CAMK; Kinase, protein; Protein kinase, Ser/Thr (non-receptor); CAMK group; CAMKL family; BRSK subfamily
Chromosomal Location of Human Ortholog: 11p15.5
Cellular Component: centrosome; endoplasmic reticulum; perinuclear region of cytoplasm; cytoplasm
Molecular Function: protein serine/threonine kinase activity; tau-protein kinase activity; magnesium ion binding; protein kinase binding; ATP binding
Biological Process: neuron differentiation; mitosis; peptidyl-serine phosphorylation; exocytosis; axonogenesis; cell division; establishment of cell polarity; actin cytoskeleton reorganization; G2/M transition of mitotic cell cycle; protein amino acid phosphorylation
Research Articles on BRSK2
Similar Products
Product Notes
The BRSK2 brsk2 (Catalog #AAA3222599) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The BRSK2 Antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's BRSK2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the BRSK2 brsk2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: CFRDRNKLLQ DLLSEEENQE KMIYFLLLDR KERYPSQEDE DLPPRNEIDP. It is sometimes possible for the material contained within the vial of "BRSK2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
