Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: BRS3Sample Tissue: Human HepG2 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Rabbit anti-Human BRS3 Polyclonal Antibody | anti-BRS3 antibody

BRS3 Antibody - middle region

Gene Names
BRS3; BB3; BB3R
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
BRS3; Polyclonal Antibody; BRS3 Antibody - middle region; anti-BRS3 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: TLNIPTEEQSHARKQIESRKRIARTVLVLVALFALCWLPNHLLYLYHSFT
Sequence Length
399
Applicable Applications for anti-BRS3 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human BRS3
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: BRS3Sample Tissue: Human HepG2 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: BRS3Sample Tissue: Human HepG2 Whole Cell lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-BRS3 antibody
The protein encoded by this gene is a G protein-coupled membrane receptor that binds bombesin-like peptides. This binding results in activation of a phosphatidylinositol-calcium second messenger system, with physiological effects including regulation of metabolic rate, glucose metabolism, and hypertension.
Product Categories/Family for anti-BRS3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
680
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
43 kDa
NCBI Official Full Name
bombesin receptor subtype-3
NCBI Official Synonym Full Names
bombesin receptor subtype 3
NCBI Official Symbol
BRS3
NCBI Official Synonym Symbols
BB3; BB3R
NCBI Protein Information
bombesin receptor subtype-3
UniProt Protein Name
Bombesin receptor subtype-3
Protein Family
UniProt Gene Name
BRS3
UniProt Synonym Gene Names
BRS-3
UniProt Entry Name
BRS3_HUMAN

NCBI Description

The protein encoded by this gene is a G protein-coupled membrane receptor that binds bombesin-like peptides. This binding results in activation of a phosphatidylinositol-calcium second messenger system, with physiological effects including regulation of metabolic rate, glucose metabolism, and hypertension. [provided by RefSeq, Sep 2011]

Uniprot Description

BRS3: Role in sperm cell division, maturation, or function. This receptor mediates its action by association with G proteins that activate a phosphatidylinositol-calcium second messenger system. Belongs to the G-protein coupled receptor 1 family.

Protein type: Membrane protein, integral; Receptor, GPCR; Membrane protein, multi-pass; GPCR, family 1

Chromosomal Location of Human Ortholog: Xq26.3

Cellular Component: neuron projection; cell soma; plasma membrane; integral to membrane

Molecular Function: bombesin receptor activity

Biological Process: regulation of blood pressure; bombesin receptor signaling pathway; glucose metabolic process; adult feeding behavior

Research Articles on BRS3

Similar Products

Product Notes

The BRS3 brs3 (Catalog #AAA3222637) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The BRS3 Antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's BRS3 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the BRS3 brs3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: TLNIPTEEQS HARKQIESRK RIARTVLVLV ALFALCWLPN HLLYLYHSFT. It is sometimes possible for the material contained within the vial of "BRS3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.