Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-BDH2 Antibody Titration: 0.2-1 ug/mlPositive Control: Jurkat cell lysate)

Rabbit BDH2 Polyclonal Antibody | anti-BDH2 antibody

BDH2 antibody - middle region

Gene Names
BDH2; DHRS6; EFA6R; SDR15C1; UCPA-OR; UNQ6308; PRO20933
Reactivity
Cow, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
BDH2; Polyclonal Antibody; BDH2 antibody - middle region; anti-BDH2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: NRCVYSTTKAAVIGLTKSVAADFIQQGIRCNCVCPGTVDTPSLQERIQAR
Sequence Length
245
Applicable Applications for anti-BDH2 antibody
Western Blot (WB)
Homology
Cow: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human BDH2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-BDH2 Antibody Titration: 0.2-1 ug/mlPositive Control: Jurkat cell lysate)

Western Blot (WB) (WB Suggested Anti-BDH2 Antibody Titration: 0.2-1 ug/mlPositive Control: Jurkat cell lysate)
Related Product Information for anti-BDH2 antibody
This is a rabbit polyclonal antibody against BDH2. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: The function of this protein remains unknown.
Product Categories/Family for anti-BDH2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
27kDa
NCBI Official Full Name
3-hydroxybutyrate dehydrogenase type 2
NCBI Official Synonym Full Names
3-hydroxybutyrate dehydrogenase 2
NCBI Official Symbol
BDH2
NCBI Official Synonym Symbols
DHRS6; EFA6R; SDR15C1; UCPA-OR; UNQ6308; PRO20933
NCBI Protein Information
3-hydroxybutyrate dehydrogenase type 2
UniProt Protein Name
3-hydroxybutyrate dehydrogenase type 2
UniProt Gene Name
BDH2
UniProt Synonym Gene Names
DHRS6; SDR15C1
UniProt Entry Name
BDH2_HUMAN

Uniprot Description

DHRS6: Dehydrogenase that mediates the formation of 2,5- dihydroxybenzoic acid (2,5-DHBA), a siderophore that shares structural similarities with bacterial enterobactin and associates with LCN2, thereby playing a key role in iron homeostasis and transport. Also acts as a 3-hydroxybutyrate dehydrogenase. Belongs to the short-chain dehydrogenases/reductases (SDR) family. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Oxidoreductase; Carbohydrate Metabolism - butanoate; Lipid Metabolism - synthesis and degradation of ketone bodies; EC 1.1.1.30

Chromosomal Location of Human Ortholog: 4q24

Cellular Component: mitochondrion; cytoplasm

Molecular Function: 3-hydroxybutyrate dehydrogenase activity; oxidoreductase activity, acting on the CH-CH group of donors, NAD or NADP as acceptor; NAD binding

Biological Process: siderophore biosynthetic process; iron ion homeostasis; fatty acid beta-oxidation; epithelial cell differentiation; heme metabolic process

Research Articles on BDH2

Similar Products

Product Notes

The BDH2 bdh2 (Catalog #AAA3213320) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The BDH2 antibody - middle region reacts with Cow, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's BDH2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the BDH2 bdh2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: NRCVYSTTKA AVIGLTKSVA ADFIQQGIRC NCVCPGTVDT PSLQERIQAR. It is sometimes possible for the material contained within the vial of "BDH2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.