Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-Bco2 AntibodyTitration: 1.0 ug/mlPositive Control: Mouse Kidney)

Rabbit Bco2 Polyclonal Antibody | anti-BCO2 antibody

Bco2 antibody - middle region

Gene Names
Bco2; CMO2; Bcdo2; Bcmo2; B-diox-II
Reactivity
Dog, Guinea Pig, Horse, Human, Mouse, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
Bco2; Polyclonal Antibody; Bco2 antibody - middle region; anti-BCO2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Dog, Guinea Pig, Horse, Human, Mouse, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: CYNIIRVPPKKKEPGETIHGAQVLCSIASTEKMKPSYYHSFGMTKNYIIF
Sequence Length
532
Applicable Applications for anti-BCO2 antibody
Western Blot (WB)
Homology
Dog: 79%; Guinea Pig: 79%; Horse: 86%; Human: 100%; Mouse: 93%; Rat: 93%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-Bco2 AntibodyTitration: 1.0 ug/mlPositive Control: Mouse Kidney)

Western Blot (WB) (WB Suggested Anti-Bco2 AntibodyTitration: 1.0 ug/mlPositive Control: Mouse Kidney)
Related Product Information for anti-BCO2 antibody
This is a rabbit polyclonal antibody against Bco2. It was validated on Western Blot

Target Description: The function of this protein is unknown.
Product Categories/Family for anti-BCO2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
60kDa
NCBI Official Full Name
beta,beta-carotene 9',10'-oxygenase isoform 1
NCBI Official Synonym Full Names
beta-carotene oxygenase 2
NCBI Official Symbol
Bco2
NCBI Official Synonym Symbols
CMO2; Bcdo2; Bcmo2; B-diox-II
NCBI Protein Information
beta,beta-carotene 9',10'-oxygenase
UniProt Protein Name
Beta,beta-carotene 9',10'-oxygenase
UniProt Gene Name
Bco2
UniProt Synonym Gene Names
Bcdo2
UniProt Entry Name
BCDO2_MOUSE

Uniprot Description

BCDO2: Asymmetrically cleaves beta-carotene at the 9',10' double bond resulting in the formation of beta-apo-10'-carotenal and beta-ionone. Besides beta-carotene, lycopene is also oxidatively cleaved. The apocarotenals formed by this enzyme may be the precursors for the biosynthesis of retinoic acid or exert unknown physiological effects. Belongs to the carotenoid oxygenase family. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: EC 1.13.11.71; Oxidoreductase

Cellular Component: intracellular; mitochondrion

Molecular Function: dioxygenase activity; metal ion binding; oxidoreductase activity; oxidoreductase activity, acting on single donors with incorporation of molecular oxygen, incorporation of two atoms of oxygen

Biological Process: carotene catabolic process; carotene metabolic process; carotenoid metabolic process; regulation of mitochondrial membrane potential; retinal metabolic process; retinoic acid metabolic process; xanthophyll metabolic process

Research Articles on BCO2

Similar Products

Product Notes

The BCO2 bco2 (Catalog #AAA3214861) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Bco2 antibody - middle region reacts with Dog, Guinea Pig, Horse, Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's Bco2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the BCO2 bco2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: CYNIIRVPPK KKEPGETIHG AQVLCSIAST EKMKPSYYHS FGMTKNYIIF. It is sometimes possible for the material contained within the vial of "Bco2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.