Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-Pfkfb2 AntibodyTitration: 1.0 ug/mlPositive Control: Mouse Heart)

Rabbit Pfkfb2 Polyclonal Antibody | anti-PFKFB2 antibody

Pfkfb2 antibody - C-terminal region

Gene Names
Pfkfb2; 4930568D07Rik
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
Pfkfb2; Polyclonal Antibody; Pfkfb2 antibody - C-terminal region; anti-PFKFB2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: EMTYSEIEQRYPEEFALRDQEKYLYRYPGGESYQDLVQRLEPVIMELERQ
Sequence Length
518
Applicable Applications for anti-PFKFB2 antibody
Western Blot (WB)
Homology
Cow: 93%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%; Yeast: 79%; Zebrafish: 86%
Immunogen
The immunogen is a synthetic peptide corresponding to a region of Mouse
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-Pfkfb2 AntibodyTitration: 1.0 ug/mlPositive Control: Mouse Heart)

Western Blot (WB) (WB Suggested Anti-Pfkfb2 AntibodyTitration: 1.0 ug/mlPositive Control: Mouse Heart)
Related Product Information for anti-PFKFB2 antibody
This is a rabbit polyclonal antibody against Pfkfb2. It was validated on Western Blot

Target Description: The function remains unknown.
Product Categories/Family for anti-PFKFB2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
57kDa
NCBI Official Full Name
6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 2 isoform 1
NCBI Official Synonym Full Names
6-phosphofructo-2-kinase/fructose-2,6-biphosphatase 2
NCBI Official Symbol
Pfkfb2
NCBI Official Synonym Symbols
4930568D07Rik
NCBI Protein Information
6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 2
UniProt Protein Name
6-phosphofructo-2-kinase/fructose-2, 6-biphosphatase 2
UniProt Gene Name
Pfkfb2
UniProt Entry Name
Q6GTL7_MOUSE

Uniprot Description

PFKFB2 iso3: a bifunctional heterodimeric enzyme involved in both the synthesis and degradation of fructose-2,6-bisphosphate, a regulatory molecule that controls glycolysis in eukaryotes. Regulates fructose-2,6-bisphosphate levels in the heart, while a related enzyme encoded by a different gene regulates fructose-2,6-bisphosphate levels in the liver and muscle. Two splice-variant isoforms have been described.

Protein type: EC 2.7.1.105; Phosphatase (non-protein); EC 3.1.3.46; Motility/polarity/chemotaxis; Kinase, other; Carbohydrate Metabolism - fructose and mannose

Cellular Component: cytoplasm

Molecular Function: 6-phosphofructo-2-kinase activity; kinase binding; protein kinase binding

Biological Process: glucose catabolic process; glycolysis; lactate metabolic process; carbohydrate phosphorylation; response to glucose stimulus; positive regulation of insulin secretion; pyruvate metabolic process; positive regulation of glucokinase activity

Research Articles on PFKFB2

Similar Products

Product Notes

The PFKFB2 pfkfb2 (Catalog #AAA3212919) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Pfkfb2 antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's Pfkfb2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the PFKFB2 pfkfb2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: EMTYSEIEQR YPEEFALRDQ EKYLYRYPGG ESYQDLVQRL EPVIMELERQ. It is sometimes possible for the material contained within the vial of "Pfkfb2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.