Western Blot (WB)
(WB Suggested Anti-Smpdl3a AntibodyTitration: 1.0 ug/mlPositive Control: Mouse Heart)
Rabbit Smpdl3a Polyclonal Antibody | anti-SMPDL3A antibody
Smpdl3a antibody - N-terminal region
Gene Names
Smpdl3a; ASM3A; ASML3; ASML3A; AI529588; 0610010C24Rik
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
Smpdl3a; Polyclonal Antibody; Smpdl3a antibody - N-terminal region; anti-SMPDL3A antibody
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: YQLILSAFDFIKNSGQEASFMIWTGDSPPHVPVPELSTGTVIKVITNMTM
Sequence Length
445
Applicable Applications for anti-SMPDL3A antibody
Western Blot (WB)
Homology
Cow: 93%; Dog: 93%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%; Zebrafish: 86%
Immunogen
The immunogen is a synthetic peptide corresponding to a region of Mouse
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(WB Suggested Anti-Smpdl3a AntibodyTitration: 1.0 ug/mlPositive Control: Mouse Heart)
Western Blot (WB)
(WB Suggested Anti-Smpdl3a AntibodyTitration: 1.0 ug/mlPositive Control: Mouse Heart)
Related Product Information for anti-SMPDL3A antibody
This is a rabbit polyclonal antibody against Smpdl3a. It was validated on Western Blot
Target Description: The function of this protein remains unknown.
Target Description: The function of this protein remains unknown.
Product Categories/Family for anti-SMPDL3A antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
49kDa
NCBI Official Full Name
acid sphingomyelinase-like phosphodiesterase 3a
NCBI Official Synonym Full Names
sphingomyelin phosphodiesterase, acid-like 3A
NCBI Official Symbol
Smpdl3a
NCBI Official Synonym Symbols
ASM3A; ASML3; ASML3A; AI529588; 0610010C24Rik
NCBI Protein Information
acid sphingomyelinase-like phosphodiesterase 3a
UniProt Protein Name
Acid sphingomyelinase-like phosphodiesterase 3a
Protein Family
UniProt Gene Name
Smpdl3a
UniProt Synonym Gene Names
Asml3a; ASM-like phosphodiesterase 3a
UniProt Entry Name
ASM3A_MOUSE
Uniprot Description
SMPDL3A: Belongs to the acid sphingomyelinase family.
Protein type: EC 3.1.4.-; Secreted; Phosphodiesterase; Secreted, signal peptide
Cellular Component: extracellular space; extracellular region
Molecular Function: 3',5'-cyclic-AMP phosphodiesterase activity; cGMP-inhibited cyclic-nucleotide phosphodiesterase activity; calmodulin-dependent cyclic-nucleotide phosphodiesterase activity; photoreceptor cyclic-nucleotide phosphodiesterase activity; sphingomyelin phosphodiesterase activity; hydrolase activity; hydrolase activity, acting on glycosyl bonds; cGMP-stimulated cyclic-nucleotide phosphodiesterase activity; cyclic-nucleotide phosphodiesterase activity
Biological Process: metabolic process; sphingomyelin catabolic process
Research Articles on SMPDL3A
Similar Products
Product Notes
The SMPDL3A smpdl3a (Catalog #AAA3210684) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Smpdl3a antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's Smpdl3a can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the SMPDL3A smpdl3a for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: YQLILSAFDF IKNSGQEASF MIWTGDSPPH VPVPELSTGT VIKVITNMTM. It is sometimes possible for the material contained within the vial of "Smpdl3a, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
