Rabbit anti-Human BCLAF1 Polyclonal Antibody | anti-BCLAF1 antibody

BCLAF1 Antibody - middle region

Cat. Num. AAA3222516

• Gene Names: BCLAF1; BTF; bK211L9.1
• Reactivity: Human
• Applications: Western Blot
• Purity: Affinity purified
• Synonyms: BCLAF1; Polyclonal Antibody; BCLAF1 Antibody - middle region; anti-BCLAF1 antibody

• Host: Rabbit
• Reactivity: Human
• Clonality: Polyclonal
• Purity/Purification: Affinity purified
• Form/Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Sequence: Synthetic peptide located within the following region: YKDDSKHKREQDHSRSSSSSASPSSPSSREEKESKKEREEEFKTHHEMKE
• Sequence Length: 920

• Applicable Applications for anti-BCLAF1 antibody: Western Blot (WB)
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human BCLAF1
• Preparation and Storage: For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: BCLAF1Sample Tissue: Human DLD1 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Related Product Information for anti-BCLAF1 antibody

This gene encodes a transcriptional repressor that interacts with several members of the BCL2 family of proteins. Overexpression of this protein induces apoptosis, which can be suppressed by co-expression of BCL2 proteins. The protein localizes to dot-like structures throughout the nucleus, and redistributes to a zone near the nuclear envelope in cells undergoing apoptosis. Multiple transcript variants encoding different isoforms have been found for this gene.

Product Categories/Family for anti-BCLAF1 antibody

Polyclonal; Transcription Factor; Apoptosis

NCBI and Uniprot Product Information

• NCBI GI #: 117938251
• NCBI GeneID: 9774
• NCBI Accession #: NP_001070908.1
• NCBI GenBank Nucleotide #: NM_001077440.1
• UniProt Accession #: Q9NYF8
• Molecular Weight: 101 kDa
• NCBI Official Full Name: bcl-2-associated transcription factor 1 isoform 2
• NCBI Official Synonym Full Names: BCL2 associated transcription factor 1
• NCBI Official Symbol: BCLAF1
• NCBI Official Synonym Symbols: BTF; bK211L9.1
• NCBI Protein Information: bcl-2-associated transcription factor 1
• UniProt Protein Name: Bcl-2-associated transcription factor 1
• Protein Family: Bcl-2-associated transcription factor
• UniProt Gene Name: BCLAF1
• UniProt Synonym Gene Names: BTF; KIAA0164; Btf
• UniProt Entry Name: BCLF1_HUMAN

NCBI Description

This gene encodes a transcriptional repressor that interacts with several members of the BCL2 family of proteins. Overexpression of this protein induces apoptosis, which can be suppressed by co-expression of BCL2 proteins. The protein localizes to dot-like structures throughout the nucleus, and redistributes to a zone near the nuclear envelope in cells undergoing apoptosis. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008]

Uniprot Description

BCLAF1: a ubiquitous death-promoting transcriptional repressor. Interacts with Bcl-2 related proteins, lamin A, emerin, the adenovirus E1B 19 kDa protein and DNA. An emerin mutant S54F, which binds normally to barrier-to-autointegration factor (BAF), lamin A and GCL, selectively disrupts its binding to BCLAF1. BCLAF1 is found in dot-like structures throughout the nuclear interior in HeLa cells. Proapoptotic stimuli induce its redistribution to a distinct zone near the nuclear envelope. Four alternatively spliced human isoforms have been described.

Protein type: RNA-binding; Transcription factor

Chromosomal Location of Human Ortholog: 6q23.3

Cellular Component: nucleoplasm; cytoplasm; nucleolus; nucleus

Molecular Function: protein binding; DNA binding

Biological Process: regulation of transcription in response to stress; transcription, DNA-dependent; apoptosis; positive regulation of apoptosis; negative regulation of transcription, DNA-dependent