Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: BCL10Sample Tissue: Human Du145 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Rabbit anti-Human BCL10 Polyclonal Antibody | anti-BCL10 antibody

BCL10 Antibody - middle region

Gene Names
BCL10; CLAP; mE10; CIPER; IMD37; c-E10; CARMEN
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
BCL10; Polyclonal Antibody; BCL10 Antibody - middle region; anti-BCL10 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: CEPFPDGATNNLSRSNSDESNFSEKLRASTVMYHPEGESSTTPFFSTNSS
Sequence Length
233
Applicable Applications for anti-BCL10 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the middle terminal region of human BCL10
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: BCL10Sample Tissue: Human Du145 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: BCL10Sample Tissue: Human Du145 Whole Cell lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-BCL10 antibody
This gene was identified by its translocation in a case of mucosa-associated lymphoid tissue (MALT) lymphoma. The protein encoded by this gene contains a caspase recruitment domain (CARD), and has been shown to induce apoptosis and to activate NF-kappaB. This protein is reported to interact with other CARD domain containing proteins including CARD9, 10, 11 and 14, which are thought to function as upstream regulators in NF-kappaB signaling. This protein is found to form a complex with MALT1, a protein encoded by another gene known to be translocated in MALT lymphoma. MALT1 and this protein are thought to synergize in the activation of NF-kappaB, and the deregulation of either of them may contribute to the same pathogenetic process that leads to the malignancy. Alternative splicing results in multiple transcript variants.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
25 kDa
NCBI Official Full Name
B-cell lymphoma/leukemia 10 isoform 1
NCBI Official Synonym Full Names
BCL10 immune signaling adaptor
NCBI Official Symbol
BCL10
NCBI Official Synonym Symbols
CLAP; mE10; CIPER; IMD37; c-E10; CARMEN
NCBI Protein Information
B-cell lymphoma/leukemia 10
UniProt Protein Name
B-cell lymphoma/leukemia 10
Protein Family
UniProt Gene Name
BCL10
UniProt Synonym Gene Names
CIPER; CLAP; Bcl-10; hCLAP; CIPER; cCARMEN; c-E10; mE10
UniProt Entry Name
BCL10_HUMAN

NCBI Description

This gene was identified by its translocation in a case of mucosa-associated lymphoid tissue (MALT) lymphoma. The protein encoded by this gene contains a caspase recruitment domain (CARD), and has been shown to induce apoptosis and to activate NF-kappaB. This protein is reported to interact with other CARD domain containing proteins including CARD9, 10, 11 and 14, which are thought to function as upstream regulators in NF-kappaB signaling. This protein is found to form a complex with MALT1, a protein encoded by another gene known to be translocated in MALT lymphoma. MALT1 and this protein are thought to synergize in the activation of NF-kappaB, and the deregulation of either of them may contribute to the same pathogenetic process that leads to the malignancy. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Mar 2016]

Uniprot Description

Bcl-10: a ubiquitous pro-apoptotic protein that promotes pro-caspase-9 maturation and activation of NF-kappa-B via NIK and IKK. May be an adapter protein between upstream TNFR1-TRADD-RIP complex and the downstream NIK-IKK-IKAP complex. Self-associates via CARD-CARD interactions; forms a tight complex with MALT1. Interacts with other CARD-proteins such as CARD9, CARD10, CARD11 and CARD14. Binds caspase-9 with its C-terminal domain. Interacts with TRAF2 and BIRC2/c-IAP2. Defects in BCL10 are involved in various types of cancer.

Protein type: Apoptosis; Tumor suppressor; Transcription, coactivator/corepressor

Chromosomal Location of Human Ortholog: 1p22

Cellular Component: CBM complex; protein complex; lysosome; immunological synapse; cytosol; lipid raft; T cell receptor complex; cytoplasmic microtubule; perinuclear region of cytoplasm; cytoplasm; plasma membrane; lipopolysaccharide receptor complex; nucleus

Molecular Function: protein C-terminus binding; protein kinase B binding; ubiquitin binding; protease binding; protein self-association; transcription coactivator activity; transcription factor binding; protein kinase binding; NF-kappaB binding; protein binding; enzyme binding; ubiquitin protein ligase binding; kinase activator activity; kinase binding

Biological Process: cell death; response to fungus; positive regulation of transcription, DNA-dependent; positive regulation of caspase activity; B cell apoptosis; T cell receptor signaling pathway; interleukin-6 biosynthetic process; activation of NF-kappaB transcription factor; negative regulation of mature B cell apoptosis; response to molecule of bacterial origin; protein homooligomerization; response to food; adaptive immune response; positive regulation of I-kappaB kinase/NF-kappaB cascade; positive regulation of interleukin-8 biosynthetic process; protein oligomerization; positive regulation of protein ubiquitination; lymphotoxin A biosynthetic process; regulation of T cell receptor signaling pathway; neural tube closure; toll-like receptor signaling pathway; innate immune response; cellular defense response; positive regulation of mast cell cytokine production; positive regulation of T cell activation; immunoglobulin mediated immune response; positive regulation of phosphorylation

Disease: Follicular Lymphoma, Susceptibility To, 1; Mesothelioma, Malignant; Gastric Lymphoma, Primary; Testicular Germ Cell Tumor; Immunodeficiency 37

Research Articles on BCL10

Similar Products

Product Notes

The BCL10 bcl10 (Catalog #AAA3223366) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The BCL10 Antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's BCL10 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the BCL10 bcl10 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: CEPFPDGATN NLSRSNSDES NFSEKLRAST VMYHPEGESS TTPFFSTNSS. It is sometimes possible for the material contained within the vial of "BCL10, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.