Western Blot (WB)
(Host: RabbitTarget Name: RRP15Sample Type: A549 Whole Cell lysatesAntibody Dilution: 1.0ug/mlRRP15 is supported by BioGPS gene expression data to be expressed in A549)
Rabbit anti-Human RRP15 Polyclonal Antibody | anti-RRP15 antibody
RRP15 Antibody - C-terminal region
Gene Names
RRP15; CGI-115; KIAA0507
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
RRP15; Polyclonal Antibody; RRP15 Antibody - C-terminal region; anti-RRP15 antibody
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: ISTVSKKDFISVLRGMDGSTNETASSRKKPKAKQTEVKSEEGPGWTILRD
Sequence Length
259
Applicable Applications for anti-RRP15 antibody
Western Blot (WB)
Homology
Human: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Human RRP15
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(Host: RabbitTarget Name: RRP15Sample Type: A549 Whole Cell lysatesAntibody Dilution: 1.0ug/mlRRP15 is supported by BioGPS gene expression data to be expressed in A549)
Western Blot (WB)
(Host: RabbitTarget Name: RRP15Sample Type: A549 Whole Cell lysatesAntibody Dilution: 1.0ug/mlRRP15 is supported by BioGPS gene expression data to be expressed in A549)
Related Product Information for anti-RRP15 antibody
This is a rabbit polyclonal antibody against RRP15. It was validated on Western Blot
Target Description: This gene encodes a protein that co-purifies with human nucleoli. A similar protein in budding yeast is a component of pre-60S ribosomal particles, and is required for the early maturation steps of the 60S subunit.
Target Description: This gene encodes a protein that co-purifies with human nucleoli. A similar protein in budding yeast is a component of pre-60S ribosomal particles, and is required for the early maturation steps of the 60S subunit.
Product Categories/Family for anti-RRP15 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
28kDa
NCBI Official Full Name
RRP15-like protein
NCBI Official Synonym Full Names
ribosomal RNA processing 15 homolog
NCBI Official Symbol
RRP15
NCBI Official Synonym Symbols
CGI-115; KIAA0507
NCBI Protein Information
RRP15-like protein
UniProt Protein Name
RRP15-like protein
Protein Family
UniProt Gene Name
RRP15
UniProt Synonym Gene Names
KIAA0507; CGI-115
UniProt Entry Name
RRP15_HUMAN
NCBI Description
This gene encodes a protein that co-purifies with human nucleoli. A similar protein in budding yeast is a component of pre-60S ribosomal particles, and is required for the early maturation steps of the 60S subunit. [provided by RefSeq, Jul 2008]
Research Articles on RRP15
Similar Products
Product Notes
The RRP15 rrp15 (Catalog #AAA3217888) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The RRP15 Antibody - C-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's RRP15 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the RRP15 rrp15 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: ISTVSKKDFI SVLRGMDGST NETASSRKKP KAKQTEVKSE EGPGWTILRD. It is sometimes possible for the material contained within the vial of "RRP15, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
