Western Blot (WB)
(Western blot analysis of extracts of various cell lines, using B3GNT3 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 180s.)
Rabbit B3GNT3 Polyclonal Antibody | anti-B3GNT3 antibody
B3GNT3 Rabbit pAb
Gene Names
B3GNT3; TMEM3; B3GN-T3; B3GNT-3; HP10328; B3GAL-T8; beta3Gn-T3
Reactivity
Human, Mouse, Rat
Applications
Western Blot, Immunohistochemistry
Purity
Affinity purification
Synonyms
B3GNT3; Polyclonal Antibody; B3GNT3 Rabbit pAb; B3GAL-T8; B3GN-T3; B3GNT-3; HP10328; TMEM3; beta3Gn-T3; anti-B3GNT3 antibody
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Sequence
YVRRELLRRTWGRERKVRGLQLRLLFLVGTASNPHEARKVNRLLELEAQTHGDILQWDFHDSFFNLTLKQVLFLQWQETRCANASFVLNGDDDVFAHTDNMVFYLQDHDPGRHLFVGQLIQ
Applicable Applications for anti-B3GNT3 antibody
Western Blot (WB), Immunohistochemistry (IHC)
Application Notes
WB: 1:500-1:2000
IHC: 1:50-1:200
IHC: 1:50-1:200
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 120-240 of human B3GNT3 (NP_055071.2).
Positive Samples
SGC-7901, 293T, Mouse stomach
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.
Western Blot (WB)
(Western blot analysis of extracts of various cell lines, using B3GNT3 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 180s.)
Western Blot (WB)
(Western blot analysis of extracts of various cell lines, using B3GNT3 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 180s.)
Immunohistochemistry (IHC)
(Immunohistochemistry of paraffin-embedded Human liver using B3GNT3 Rabbit pAb at dilution of 1:100 (40x lens).)
Immunohistochemistry (IHC)
(Immunohistochemistry of paraffin-embedded Human liver using B3GNT3 Rabbit pAb at dilution of 1:100 (40x lens).)
Immunohistochemistry (IHC)
(Immunohistochemistry of paraffin-embedded Rat ovary using B3GNT3 Rabbit pAb at dilution of 1:100 (40x lens).)
Immunohistochemistry (IHC)
(Immunohistochemistry of paraffin-embedded Rat ovary using B3GNT3 Rabbit pAb at dilution of 1:100 (40x lens).)
Related Product Information for anti-B3GNT3 antibody
Background: This gene encodes a member of the beta-1, 3-N-acetylglucosaminyltransferase family. This enzyme is a type II transmembrane protein and contains a signal anchor that is not cleaved. It prefers the substrates of lacto-N-tetraose and lacto-N-neotetraose, and is involved in the biosynthesis of poly-N-acetyllactosamine chains and the biosynthesis of the backbone structure of dimeric sialyl Lewis a. It plays dominant roles in L-selectin ligand biosynthesis, lymphocyte homing and lymphocyte trafficking. [provided by RefSeq, Jul 2008]
Product Categories/Family for anti-B3GNT3 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
42,534 Da
NCBI Official Full Name
N-acetyllactosaminide beta-1,3-N-acetylglucosaminyltransferase 3
NCBI Official Synonym Full Names
UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 3
NCBI Official Symbol
B3GNT3
NCBI Official Synonym Symbols
TMEM3; B3GN-T3; B3GNT-3; HP10328; B3GAL-T8; beta3Gn-T3
NCBI Protein Information
N-acetyllactosaminide beta-1,3-N-acetylglucosaminyltransferase 3; UDP-Gal:beta-GlcNAc beta-1,3-galactosyltransferase 8; UDP-galactose:beta-N-acetylglucosamine beta-1,3-galactosyltransferase 8; beta-1,3-GalTase 8; beta-1,3-Gn-T3; beta-1,3-N-acetylglucosami
UniProt Protein Name
N-acetyllactosaminide beta-1,3-N-acetylglucosaminyltransferase 3
UniProt Gene Name
B3GNT3
UniProt Entry Name
B3GN3_HUMAN
Similar Products
Product Notes
The B3GNT3 b3gnt3 (Catalog #AAA9142877) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The B3GNT3 Rabbit pAb reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's B3GNT3 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB), Immunohistochemistry (IHC). WB: 1:500-1:2000 IHC: 1:50-1:200. Researchers should empirically determine the suitability of the B3GNT3 b3gnt3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: YVRRELLRRT WGRERKVRGL QLRLLFLVGT ASNPHEARKV NRLLELEAQT HGDILQWDFH DSFFNLTLKQ VLFLQWQETR CANASFVLNG DDDVFAHTDN MVFYLQDHDP GRHLFVGQLI Q. It is sometimes possible for the material contained within the vial of "B3GNT3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
