Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-B3GALTL Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:12500Positive Control: SH-SYSY cell lysate)

Rabbit B3GLCT Polyclonal Antibody | anti-B3GLCT antibody

B3GLCT Antibody - middle region

Gene Names
B3GLCT; B3GTL; Gal-T; B3GALTL; B3Glc-T; beta3Glc-T
Reactivity
Dog, Human, Mouse, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
B3GLCT; Polyclonal Antibody; B3GLCT Antibody - middle region; anti-B3GLCT antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Dog, Human, Mouse, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: DYPKDYLSHQVPISFHKHWNIDPVKVYFTWLAPSDEDKARQETQKGFREE
Sequence Length
498
Applicable Applications for anti-B3GLCT antibody
Western Blot (WB)
Homology
Dog: 93%; Human: 100%; Mouse: 79%; Rat: 79%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human B3GALTL
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-B3GALTL Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:12500Positive Control: SH-SYSY cell lysate)

Western Blot (WB) (WB Suggested Anti-B3GALTL Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:12500Positive Control: SH-SYSY cell lysate)
Related Product Information for anti-B3GLCT antibody
This is a rabbit polyclonal antibody against B3GALTL. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: The protein encoded by this gene is a beta-1,3-glucosyltransferase that transfers glucose to O-linked fucosylglycans on thrombospondin type-1 repeats (TSRs) of several proteins. The encoded protein is a type II membrane protein. Defects in this gene are a cause of Peters-plus syndrome (PPS).
Product Categories/Family for anti-B3GLCT antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
56kDa
NCBI Official Full Name
beta-1,3-glucosyltransferase
NCBI Official Synonym Full Names
beta 3-glucosyltransferase
NCBI Official Symbol
B3GLCT
NCBI Official Synonym Symbols
B3GTL; Gal-T; B3GALTL; B3Glc-T; beta3Glc-T
NCBI Protein Information
beta-1,3-glucosyltransferase
UniProt Protein Name
Beta-1,3-glucosyltransferase
UniProt Gene Name
B3GALTL
UniProt Synonym Gene Names
B3GTL; Beta3Glc-T
UniProt Entry Name
B3GLT_HUMAN

NCBI Description

The protein encoded by this gene is a beta-1,3-glucosyltransferase that transfers glucose to O-linked fucosylglycans on thrombospondin type-1 repeats (TSRs) of several proteins. The encoded protein is a type II membrane protein. Defects in this gene are a cause of Peters-plus syndrome (PPS).[provided by RefSeq, Mar 2009]

Uniprot Description

B3GALTL: O-fucosyltransferase that transfers glucose toward fucose with a beta-1,3 linkage. Specifically glucosylates O-linked fucosylglycan on TSP type-1 domains of proteins, thereby contributing to elongation of O-fucosylglycan. Defects in B3GALTL are the cause of Peters-plus syndrome (PpS). PpS is an autosomal recessive disorder characterized by anterior eye-chamber abnormalities, disproportionate short stature, developmental delay, characteristic craniofacial features, cleft lip and/or palate. Belongs to the glycosyltransferase 31 family.

Protein type: Transferase; EC 2.4.1.-; Membrane protein, integral

Chromosomal Location of Human Ortholog: 13q12.3

Cellular Component: endoplasmic reticulum membrane; integral to membrane

Molecular Function: transferase activity, transferring glycosyl groups

Biological Process: fucose metabolic process; protein amino acid O-linked glycosylation; cellular protein metabolic process; post-translational protein modification

Disease: Peters-plus Syndrome

Research Articles on B3GLCT

Similar Products

Product Notes

The B3GLCT b3galtl (Catalog #AAA3209355) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The B3GLCT Antibody - middle region reacts with Dog, Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's B3GLCT can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the B3GLCT b3galtl for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: DYPKDYLSHQ VPISFHKHWN IDPVKVYFTW LAPSDEDKAR QETQKGFREE. It is sometimes possible for the material contained within the vial of "B3GLCT, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.