Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-RDH12 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Transfected 293T)

Rabbit RDH12 Polyclonal Antibody | anti-RDH12 antibody

RDH12 antibody - middle region

Gene Names
RDH12; RP53; LCA13; SDR7C2
Reactivity
Dog, Human, Pig, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
RDH12; Polyclonal Antibody; RDH12 antibody - middle region; anti-RDH12 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Dog, Human, Pig, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: HIGKIPFHDLQSEKRYSRGFAYCHSKLANVLFTRELAKRLQGTGVTTYAV
Sequence Length
316
Applicable Applications for anti-RDH12 antibody
Western Blot (WB)
Homology
Dog: 93%; Human: 100%; Pig: 79%; Rat: 79%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human RDH12
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-RDH12 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Transfected 293T)

Western Blot (WB) (WB Suggested Anti-RDH12 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Transfected 293T)
Related Product Information for anti-RDH12 antibody
This is a rabbit polyclonal antibody against RDH12. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: RDH12 is an NADPH-dependent retinal reductase whose highest activity is toward 9-cis and all-trans-retinol. RDH12 also plays a role in the metabolism of short-chain aldehydes but does not exhibit steroid dehydrogenase activity. Defects in this gene are a cause of Leber congenital amaurosis type 3 (LCA3).The protein encoded by this gene is an NADPH-dependent retinal reductase whose highest activity is toward 9-cis and all-trans-retinol. The encoded enzyme also plays a role in the metabolism of short-chain aldehydes but does not exhibit steroid dehydrogenase activity. Defects in this gene are a cause of Leber congenital amaurosis type 3 (LCA3).
Product Categories/Family for anti-RDH12 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
35kDa
NCBI Official Full Name
retinol dehydrogenase 12
NCBI Official Synonym Full Names
retinol dehydrogenase 12
NCBI Official Symbol
RDH12
NCBI Official Synonym Symbols
RP53; LCA13; SDR7C2
NCBI Protein Information
retinol dehydrogenase 12
UniProt Protein Name
Retinol dehydrogenase 12
Protein Family
UniProt Gene Name
RDH12
UniProt Entry Name
RDH12_HUMAN

NCBI Description

The protein encoded by this gene is an NADPH-dependent retinal reductase whose highest activity is toward 9-cis and all-trans-retinol. The encoded enzyme also plays a role in the metabolism of short-chain aldehydes but does not exhibit steroid dehydrogenase activity. Defects in this gene are a cause of Leber congenital amaurosis type 13 and Retinitis Pigmentosa 53. [provided by RefSeq, Sep 2015]

Uniprot Description

RDH12: Exhibits an oxidoreductive catalytic activity towards retinoids. Most efficient as an NADPH-dependent retinal reductase. Displays high activity toward 9-cis and all-trans-retinol. Also involved in the metabolism of short-chain aldehydes. No steroid dehydrogenase activity detected. Might be the key enzyme in the formation of 11-cis-retinal from 11-cis-retinol during regeneration of the cone visual pigments. Defects in RDH12 are the cause of Leber congenital amaurosis type 13 (LCA13). LCA designates a clinically and genetically heterogeneous group of childhood retinal degenerations, generally inherited in an autosomal recessive manner. Affected infants have little or no retinal photoreceptor function as tested by electroretinography. LCA represents the most common genetic cause of congenital visual impairment in infants and children. Defects in RDH12 are the cause of retinitis pigmentosa type 53 (RP53). RP53 is a retinal dystrophy belonging to the group of pigmentary retinopathies. Retinitis pigmentosa is characterized by retinal pigment deposits visible on fundus examination and primary loss of rod photoreceptor cells followed by secondary loss of cone photoreceptors. Patients typically have night vision blindness and loss of midperipheral visual field. As their condition progresses, they lose their far peripheral visual field and eventually central vision as well. Belongs to the short-chain dehydrogenases/reductases (SDR) family.

Protein type: EC 1.1.1.-; Oxidoreductase; Cofactor and Vitamin Metabolism - retinol

Chromosomal Location of Human Ortholog: 14q24.1

Cellular Component: intracellular

Molecular Function: protein binding; retinol dehydrogenase activity

Biological Process: phototransduction, visible light; visual perception; retinol metabolic process; photoreceptor cell maintenance; retinoid metabolic process

Disease: Leber Congenital Amaurosis 13

Research Articles on RDH12

Similar Products

Product Notes

The RDH12 rdh12 (Catalog #AAA3211071) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The RDH12 antibody - middle region reacts with Dog, Human, Pig, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's RDH12 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the RDH12 rdh12 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: HIGKIPFHDL QSEKRYSRGF AYCHSKLANV LFTRELAKRL QGTGVTTYAV. It is sometimes possible for the material contained within the vial of "RDH12, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.