Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: Atp1a1Sample Type: Rat Small Intestine lysatesAntibody Dilution: 1.0ug/ml)

Rabbit Atp1a1 Polyclonal Antibody | anti-ATP1A1 antibody

Atp1a1 Antibody - middle region

Gene Names
Atp1a1; Nkaa1b
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
Atp1a1; Polyclonal Antibody; Atp1a1 Antibody - middle region; anti-ATP1A1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: KHLLVMKGAPERILDRCSSILLHGKEQPLDEELKDAFQNAYLELGGLGER
Sequence Length
1023
Applicable Applications for anti-ATP1A1 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%; Zebrafish: 86%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of Rat Atp1a1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: Atp1a1Sample Type: Rat Small Intestine lysatesAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: Atp1a1Sample Type: Rat Small Intestine lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-ATP1A1 antibody
This is a rabbit polyclonal antibody against Atp1a1. It was validated on Western Blot

Target Description: Atp1a1 mediates Na+ and K+ transport; It may play a role in regulation of blood pressure.
Product Categories/Family for anti-ATP1A1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
112kDa
NCBI Official Full Name
sodium/potassium-transporting ATPase subunit alpha-1
NCBI Official Synonym Full Names
ATPase Na+/K+ transporting subunit alpha 1
NCBI Official Symbol
Atp1a1
NCBI Official Synonym Symbols
Nkaa1b
NCBI Protein Information
sodium/potassium-transporting ATPase subunit alpha-1
UniProt Protein Name
Sodium/potassium-transporting ATPase subunit alpha-1
UniProt Gene Name
Atp1a1
UniProt Synonym Gene Names
Na(+)/K(+) ATPase alpha-1 subunit

NCBI Description

mediates Na+ and K+ transport; may play a role in regulation of blood pressure [RGD, Feb 2006]

Uniprot Description

This is the catalytic component of the active enzyme, which catalyzes the hydrolysis of ATP coupled with the exchange of sodium and potassium ions across the plasma membrane. This action creates the electrochemical gradient of sodium and potassium ions, providing the energy for active transport of various nutrients.

Research Articles on ATP1A1

Similar Products

Product Notes

The ATP1A1 atp1a1 (Catalog #AAA3214701) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Atp1a1 Antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's Atp1a1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the ATP1A1 atp1a1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: KHLLVMKGAP ERILDRCSSI LLHGKEQPLD EELKDAFQNA YLELGGLGER. It is sometimes possible for the material contained within the vial of "Atp1a1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.