Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-PDHA2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Human Placenta)

Rabbit PDHA2 Polyclonal Antibody | anti-PDHA2 antibody

PDHA2 antibody - N-terminal region

Gene Names
PDHA2; PDHAL
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
PDHA2; Polyclonal Antibody; PDHA2 antibody - N-terminal region; anti-PDHA2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: RMELKADQLYKQKFIRGFCHLCDGQEACCVGLEAGINPSDHVITSYRAHG
Sequence Length
388
Applicable Applications for anti-PDHA2 antibody
Western Blot (WB)
Homology
Cow: 93%; Dog: 79%; Guinea Pig: 79%; Horse: 85%; Human: 100%; Mouse: 93%; Rabbit: 100%; Rat: 86%; Zebrafish: 79%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human PDHA2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-PDHA2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Human Placenta)

Western Blot (WB) (WB Suggested Anti-PDHA2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Human Placenta)
Related Product Information for anti-PDHA2 antibody
This is a rabbit polyclonal antibody against PDHA2. It was validated on Western Blot

Target Description: The pyruvate dehydrogenase complex catalyzes the overall conversion of pyruvate to acetyl-CoA and CO2. It contains multiple copies of three enzymatic components: pyruvate dehydrogenase (E1), dihydrolipoamide acetyltransferase (E2) and lipoamide dehydrogenase (E3).
Product Categories/Family for anti-PDHA2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
43kDa
NCBI Official Full Name
pyruvate dehydrogenase E1 component subunit alpha, testis-specific form, mitochondrial
NCBI Official Synonym Full Names
pyruvate dehydrogenase E1 alpha 2 subunit
NCBI Official Symbol
PDHA2
NCBI Official Synonym Symbols
PDHAL
NCBI Protein Information
pyruvate dehydrogenase E1 component subunit alpha, testis-specific form, mitochondrial
UniProt Protein Name
Pyruvate dehydrogenase E1 component subunit alpha, testis-specific form, mitochondrial
UniProt Gene Name
PDHA2
UniProt Synonym Gene Names
PDHAL
UniProt Entry Name
ODPAT_HUMAN

Uniprot Description

PDHA2: a testis-specific mitochondrial matrix enzyme that catalyzes the oxidative decarboxylation of pyruvate, producing acetyl-CoA and CO2. A key enzyme in controlling the balance between lipid and glucose oxidation depending on substrate availability. The pyruvate dehydrogenase (PDH) holoenzyme is a multi-enzyme complex (PDHC) that contains 20-30 copies of pyruvate decarboxylase tetramers (2 alpha:2 beta)(E1), 60 copies of dihydrolipoamide acetyltransferase (E2), six homodimers of dihydrolipoamide dehydrogenase (E3), plus E3 binding proteins. The activity of PDH is tightly regulated by phosphorylation. The phosphorylation of at least one of three specific serine residues in E1 subunit by PDHK inactivates the PDHC, while dephosphorylation by PDP restores its activity. Expressed in postmeiotic spermatogenic cells.

Protein type: Carbohydrate Metabolism - pyruvate; Oxidoreductase; Carbohydrate Metabolism - butanoate; Carbohydrate Metabolism - glycolysis and gluconeogenesis; EC 1.2.4.1; Carbohydrate Metabolism - citrate (TCA) cycle; Mitochondrial; Amino Acid Metabolism - valine, leucine and isoleucine biosynthesis

Chromosomal Location of Human Ortholog: 4q22-q23

Cellular Component: mitochondrial matrix; nucleus; pyruvate dehydrogenase complex

Molecular Function: pyruvate dehydrogenase (acetyl-transferring) activity

Biological Process: acetyl-CoA biosynthetic process from pyruvate; glucose metabolic process; pyruvate metabolic process; tricarboxylic acid cycle

Research Articles on PDHA2

Similar Products

Product Notes

The PDHA2 pdha2 (Catalog #AAA3211417) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PDHA2 antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's PDHA2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the PDHA2 pdha2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: RMELKADQLY KQKFIRGFCH LCDGQEACCV GLEAGINPSD HVITSYRAHG. It is sometimes possible for the material contained within the vial of "PDHA2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.