Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-ATN1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: 721_B cell lysateThere is BioGPS gene expression data showing that ATN1 is expressed in 721_B)

Rabbit ATN1 Polyclonal Antibody | anti-ATN1 antibody

ATN1 antibody - N-terminal region

Gene Names
ATN1; B37; HRS; NOD; DRPLA; D12S755E
Reactivity
Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
ATN1; Polyclonal Antibody; ATN1 antibody - N-terminal region; anti-ATN1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: KTRQNKDSMSMRSGRKKEAPGPREELRSRGRASPGGVSTSSSDGKAEKSR
Sequence Length
1190
Applicable Applications for anti-ATN1 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human ATN1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-ATN1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: 721_B cell lysateThere is BioGPS gene expression data showing that ATN1 is expressed in 721_B)

Western Blot (WB) (WB Suggested Anti-ATN1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: 721_B cell lysateThere is BioGPS gene expression data showing that ATN1 is expressed in 721_B)
Related Product Information for anti-ATN1 antibody
This is a rabbit polyclonal antibody against ATN1. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: Dentatorubral pallidoluysian atrophy is a rare neurodegenerative disorder characterized by cerebellar ataxia, myoclonic epilepsy, choreoathetosis, and dementia. The disorder is related to the expansion of a trinucleotide repeat within ATN1. The protein includes a serine repeat and a region of alternating acidic and basic amino acids, as well as the variable glutamine repeat. Alternative splicing results in two transcripts variants that encode the same protein.Dentatorubral pallidoluysian atrophy is a rare neurodegenerative disorder characterized by cerebellar ataxia, myoclonic epilepsy, choreoathetosis, and dementia. The disorder is related to the expansion of a trinucleotide repeat within this gene. The encoded protein includes a serine repeat and a region of alternating acidic and basic amino acids, as well as the variable glutamine repeat. Alternative splicing results in two transcripts variants that encode the same protein.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
125kDa
NCBI Official Full Name
atrophin-1
NCBI Official Synonym Full Names
atrophin 1
NCBI Official Symbol
ATN1
NCBI Official Synonym Symbols
B37; HRS; NOD; DRPLA; D12S755E
NCBI Protein Information
atrophin-1
UniProt Protein Name
Atrophin-1
Protein Family
UniProt Gene Name
ATN1
UniProt Synonym Gene Names
D12S755E; DRPLA
UniProt Entry Name
ATN1_HUMAN

NCBI Description

Dentatorubral pallidoluysian atrophy (DRPLA) is a rare neurodegenerative disorder characterized by cerebellar ataxia, myoclonic epilepsy, choreoathetosis, and dementia. The disorder is related to the expansion from 7-35 copies to 49-93 copies of a trinucleotide repeat (CAG/CAA) within this gene. The encoded protein includes a serine repeat and a region of alternating acidic and basic amino acids, as well as the variable glutamine repeat. Alternative splicing results in two transcripts variants that encode the same protein. [provided by RefSeq, Jul 2016]

Uniprot Description

DRPLA: a protein that interacts with the E3 ubiquitin-protein ligase WWP1 and WWP2. May be involved in the third step of ubiquitin conjugation. Relatively high levels in the brain, ovary, testis and prostate. Lower levels in the liver, thymus and leukocytes. Defects are the cause of the neurodegenerative disorders dentatorubral-pallidoluysian atrophy (DRPLA) and Haw River syndrome (HRS).

Protein type: Ubiquitin conjugating system

Chromosomal Location of Human Ortholog: 12p13.31

Cellular Component: nucleoplasm; nuclear matrix; perinuclear region of cytoplasm; cytoplasm; nucleus; cell junction

Molecular Function: protein domain specific binding; protein binding; toxin receptor binding; transcription corepressor activity

Biological Process: neuron apoptosis; cell migration; central nervous system development; transcription, DNA-dependent; toxin metabolic process; negative regulation of transcription from RNA polymerase II promoter; maintenance of cell polarity

Disease: Dentatorubral-pallidoluysian Atrophy

Research Articles on ATN1

Similar Products

Product Notes

The ATN1 atn1 (Catalog #AAA3203890) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ATN1 antibody - N-terminal region reacts with Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's ATN1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the ATN1 atn1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: KTRQNKDSMS MRSGRKKEAP GPREELRSRG RASPGGVSTS SSDGKAEKSR. It is sometimes possible for the material contained within the vial of "ATN1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.