Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: ZFP36L1Sample Tissue: Human 293TAntibody Dilution: 1.0ug/ml)

Rabbit ZFP36L1 Polyclonal Antibody | anti-ZFP36L1 antibody

ZFP36L1 antibody - N-terminal region

Gene Names
ZFP36L1; BRF1; ERF1; cMG1; ERF-1; Berg36; TIS11B; RNF162B
Reactivity
Cow, Dog, Guinea Pig, Human, Mouse, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
ZFP36L1; Polyclonal Antibody; ZFP36L1 antibody - N-terminal region; anti-ZFP36L1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Human, Mouse, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: GGGFPRRHSVTLPSSKFHQNQLLSSLKGEPAPALSSRDSRFRDRSFSEGG
Sequence Length
338
Applicable Applications for anti-ZFP36L1 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Human: 100%; Mouse: 100%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human ZFP36L1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: ZFP36L1Sample Tissue: Human 293TAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: ZFP36L1Sample Tissue: Human 293TAntibody Dilution: 1.0ug/ml)

Western Blot (WB)

(Host: RabbitTarget Name: ZFP36L1Sample Tissue: Human HepG2 Whole CellAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: ZFP36L1Sample Tissue: Human HepG2 Whole CellAntibody Dilution: 1ug/ml)

Western Blot (WB)

(WB Suggested Anti-ZFP36L1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Jurkat cell lysateThere is BioGPS gene expression data showing that ZFP36L1 is expressed in Jurkat)

Western Blot (WB) (WB Suggested Anti-ZFP36L1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Jurkat cell lysateThere is BioGPS gene expression data showing that ZFP36L1 is expressed in Jurkat)
Related Product Information for anti-ZFP36L1 antibody
This is a rabbit polyclonal antibody against ZFP36L1. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: ZFP36L1 is a member of the TIS11 family of early response genes. Family members are induced by various agonists such as the phorbol ester TPA and the polypeptide mitogen EGF. The gene is well conserved across species and has a promoter that contains motifs seen in other early-response genes. The encoded protein contains a distinguishing putative zinc finger domain with a repeating cys-his motif. This putative nuclear transcription factor most likely functions in regulating the response to growth factors.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
677
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
36kDa
NCBI Official Full Name
mRNA decay activator protein ZFP36L1 isoform 1
NCBI Official Synonym Full Names
ZFP36 ring finger protein like 1
NCBI Official Symbol
ZFP36L1
NCBI Official Synonym Symbols
BRF1; ERF1; cMG1; ERF-1; Berg36; TIS11B; RNF162B
NCBI Protein Information
mRNA decay activator protein ZFP36L1
UniProt Protein Name
Zinc finger protein 36, C3H1 type-like 1
UniProt Gene Name
ZFP36L1
UniProt Synonym Gene Names
BERG36; BRF1; ERF1; RNF162B; TIS11B; ERF-1
UniProt Entry Name
TISB_HUMAN

NCBI Description

This gene is a member of the TIS11 family of early response genes, which are induced by various agonists such as the phorbol ester TPA and the polypeptide mitogen EGF. This gene is well conserved across species and has a promoter that contains motifs seen in other early-response genes. The encoded protein contains a distinguishing putative zinc finger domain with a repeating cys-his motif. This putative nuclear transcription factor most likely functions in regulating the response to growth factors. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Sep 2011]

Uniprot Description

BRF1: a zinc finger protein that plays an important role in the assembly of the RNA polymerase III initiation factor TFIIIB. Regulates mRNA levels by targeting transcripts containing AREs (AU-rich elements) into the decay pathway. Phosphorylation by Akt apparently generates 14-3-3 binding sites and inhibits BRF1 from promoting mRNA activity.Contains 2 C3H1-type zinc fingers.

Protein type: Transcription factor

Chromosomal Location of Human Ortholog: 14q22-q24

Cellular Component: nucleus; cytosol

Molecular Function: mRNA binding; protein binding; DNA binding; metal ion binding; transcription factor activity

Biological Process: regulation of translation; neural tube development; cell proliferation; regulation of transcription, DNA-dependent; apoptosis; heart development; multicellular organism growth; T cell differentiation in the thymus; gene expression; regulation of mRNA stability; vasculogenesis; mRNA catabolic process, deadenylation-dependent decay

Research Articles on ZFP36L1

Similar Products

Product Notes

The ZFP36L1 zfp36l1 (Catalog #AAA3201485) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ZFP36L1 antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's ZFP36L1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the ZFP36L1 zfp36l1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: GGGFPRRHSV TLPSSKFHQN QLLSSLKGEP APALSSRDSR FRDRSFSEGG. It is sometimes possible for the material contained within the vial of "ZFP36L1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.