Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: ATG5Sample Tissue: Mouse Liver lysatesAntibody Dilution: 1ug/ml)

Rabbit anti-Mouse ATG5 Polyclonal Antibody | anti-ATG5 antibody

ATG5 Antibody - middle region

Gene Names
Atg5; Apg5l; Atg5l; Paddy; C88337; AW319544; 2010107M05Rik; 3110067M24Rik
Reactivity
Mouse
Applications
Western Blot
Purity
Affinity purified
Synonyms
ATG5; Polyclonal Antibody; ATG5 Antibody - middle region; anti-ATG5 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Mouse
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: SQVINEMQKKDHKQLWMGLQNDRFDQFWAINRKLMEYPPEENGFRYIPFR
Sequence Length
275
Applicable Applications for anti-ATG5 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of mouse ATG5
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: ATG5Sample Tissue: Mouse Liver lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: ATG5Sample Tissue: Mouse Liver lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-ATG5 antibody
The protein encoded by this gene, in combination with autophagy protein 12, functions as an E1-like activating enzyme in a ubiquitin-like conjugating system. The encoded protein is involved in several cellular processes, including autophagic vesicle formation, mitochondrial quality control after oxidative damage, negative regulation of the innate antiviral immune response, lymphocyte development and proliferation, MHC II antigen presentation, adipocyte differentiation, and apoptosis. Two transcript variants encoding different protein isoforms have been found for this gene.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
30 kDa
NCBI Official Full Name
autophagy protein 5 isoform 2
NCBI Official Synonym Full Names
autophagy related 5
NCBI Official Symbol
Atg5
NCBI Official Synonym Symbols
Apg5l; Atg5l; Paddy; C88337; AW319544; 2010107M05Rik; 3110067M24Rik
NCBI Protein Information
autophagy protein 5
UniProt Protein Name
Autophagy protein 5
Protein Family
UniProt Gene Name
Atg5
UniProt Synonym Gene Names
Apg5l
UniProt Entry Name
ATG5_MOUSE

NCBI Description

The protein encoded by this gene, in combination with autophagy protein 12, functions as an E1-like activating enzyme in a ubiquitin-like conjugating system. The encoded protein is involved in several cellular processes, including autophagic vesicle formation, mitochondrial quality control after oxidative damage, negative regulation of the innate antiviral immune response, lymphocyte development and proliferation, MHC II antigen presentation, adipocyte differentiation, and apoptosis. Two transcript variants encoding different protein isoforms have been found for this gene. [provided by RefSeq, Sep 2015]

Uniprot Description

ATG5: Required for autophagy. Conjugates to ATG12 and associates with isolation membrane to form cup-shaped isolation membrane and autophagosome. The conjugate detaches from the membrane immediately before or after autophagosome formation is completed. The ATG5-ATG12 conjugate forms a complex with several units of ATG16. Interacts with TECPR1; the interaction is direct and does not take place when ATG16 is associated with the ATG5- ATG12 conjugate. By apoptotic stimuli. Ubiquitous. The mRNA is present at similar levels in viable and apoptotic cells, whereas the protein is dramatically highly expressed in apoptotic cells. Belongs to the ATG5 family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Apoptosis; Autophagy; Ubiquitin conjugating system

Cellular Component: membrane; cytoplasm; pre-autophagosomal structure membrane; autophagic vacuole; axoneme

Molecular Function: protein binding; APG8 conjugating enzyme activity

Biological Process: response to drug; response to fungus; immune system process; apoptosis; ventricular cardiac muscle cell development; C-terminal protein lipidation; post-translational protein modification; vasodilation; regulation of release of sequestered calcium ion into cytosol; cellular response to nitrogen starvation; heart contraction; regulation of cytokine secretion during immune response; mitochondrion degradation; autophagy; innate immune response; blood vessel remodeling; negative regulation of protein ubiquitination; otolith development; negative regulation of apoptosis; autophagic vacuole formation

Research Articles on ATG5

Similar Products

Product Notes

The ATG5 atg5 (Catalog #AAA3223575) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ATG5 Antibody - middle region reacts with Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's ATG5 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the ATG5 atg5 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: SQVINEMQKK DHKQLWMGLQ NDRFDQFWAI NRKLMEYPPE ENGFRYIPFR. It is sometimes possible for the material contained within the vial of "ATG5, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.