Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-AS3MT Antibody Titration: 0.2-1 ug/mlPositive Control: Jurkat cell lysate)

Rabbit AS3MT Polyclonal Antibody | anti-AS3MT antibody

AS3MT antibody - middle region

Gene Names
AS3MT; CYT19
Reactivity
Cow, Dog, Goat, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
AS3MT; Polyclonal Antibody; AS3MT antibody - middle region; anti-AS3MT antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Goat, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: GIKNESHDIVVSNCVINLVPDKQQVLQEAYRVLKHGGELYFSDVYTSLEL
Sequence Length
375
Applicable Applications for anti-AS3MT antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Goat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 92%; Zebrafish: 92%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human AS3MT
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-AS3MT Antibody Titration: 0.2-1 ug/mlPositive Control: Jurkat cell lysate)

Western Blot (WB) (WB Suggested Anti-AS3MT Antibody Titration: 0.2-1 ug/mlPositive Control: Jurkat cell lysate)
Related Product Information for anti-AS3MT antibody
This is a rabbit polyclonal antibody against AS3MT. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: AS3MT catalyzes the transfer of a methyl group from S-adenosyl-L-methionine (AdoMet) to trivalent arsenical and may play a role in arsenic metabolism (Lin et al., 2002 [PubMed 11790780]).
Product Categories/Family for anti-AS3MT antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
42
NCBI Official Full Name
arsenite methyltransferase
NCBI Official Synonym Full Names
arsenite methyltransferase
NCBI Official Symbol
AS3MT
NCBI Official Synonym Symbols
CYT19
NCBI Protein Information
arsenite methyltransferase
UniProt Protein Name
Arsenite methyltransferase
UniProt Gene Name
AS3MT
UniProt Synonym Gene Names
CYT19
UniProt Entry Name
AS3MT_HUMAN

NCBI Description

AS3MT catalyzes the transfer of a methyl group from S-adenosyl-L-methionine (AdoMet) to trivalent arsenical and may play a role in arsenic metabolism (Lin et al., 2002 [PubMed 11790780]).[supplied by OMIM, Mar 2008]

Uniprot Description

AS3MT: Catalyzes the transfer of a methyl group from AdoMet to trivalent arsenicals producing methylated and dimethylated arsenicals. It methylates arsenite to form methylarsonate, Me- AsO(3)H(2), which is reduced by methylarsonate reductase to methylarsonite, Me-As(OH)2. Methylarsonite is also a substrate and it is converted into the much less toxic compound dimethylarsinate (cacodylate), Me(2)As(O)-OH. Belongs to the methyltransferase superfamily.

Protein type: Methyltransferase; Mitochondrial; EC 2.1.1.137

Chromosomal Location of Human Ortholog: 10q24.32

Cellular Component: mitochondrion; cytoplasm; cytosol

Molecular Function: arsenite methyltransferase activity; methylarsonite methyltransferase activity; S-adenosylmethionine-dependent methyltransferase activity

Biological Process: methylation; arsonoacetate metabolic process; toxin metabolic process

Research Articles on AS3MT

Similar Products

Product Notes

The AS3MT as3mt (Catalog #AAA3209208) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The AS3MT antibody - middle region reacts with Cow, Dog, Goat, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's AS3MT can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the AS3MT as3mt for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: GIKNESHDIV VSNCVINLVP DKQQVLQEAY RVLKHGGELY FSDVYTSLEL. It is sometimes possible for the material contained within the vial of "AS3MT, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.