Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western blot-AS3MT Polyclonal Antibody)

Rabbit anti-Mouse AS3MT Polyclonal Antibody | anti-AS3MT antibody

AS3MT Polyclonal Antibody

Gene Names
AS3MT; CYT19
Reactivity
Mouse
Applications
Western Blot
Purity
Affinity Purification
Synonyms
AS3MT; Polyclonal Antibody; AS3MT Polyclonal Antibody; CYT19; arsenite methyltransferase; anti-AS3MT antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Mouse
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity Purification
Form/Format
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Concentration
4 mg/ml (varies by lot)
Sequence Length
375
Applicable Applications for anti-AS3MT antibody
Western Blot (WB)
Application Notes
WB: 1:500-1:2000
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 216-375 of human AS3MT (NP_065733.2).
Immunogen Sequence
LAVLAQKIGFCPPRLVTANLITIQNKELERVIGDCRFVSATFRLFKHSKTGPTKRCQVIYNGGITGHEKELMFDANFTFKEGEIVEVDEETAAILKNSRFAQDFLIRPIGEKLPTSGGCSALELKDIITDPFKLAEESDSMKSRCVPDAAGGCCGTKKSC
Positive Samples
Mouse Spleen
Cellular Location
Cytoplasm
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

Western Blot (WB)

(Western blot-AS3MT Polyclonal Antibody)

Western Blot (WB) (Western blot-AS3MT Polyclonal Antibody)
Related Product Information for anti-AS3MT antibody
AS3MT catalyzes the transfer of a methyl group from S-adenosyl-L-methionine (AdoMet) to trivalent arsenical and may play a role in arsenic metabolism.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
Calculated: 31kDa; 41kDa
Observed: 42kDa
NCBI Official Full Name
arsenite methyltransferase
NCBI Official Synonym Full Names
arsenite methyltransferase
NCBI Official Symbol
AS3MT
NCBI Official Synonym Symbols
CYT19
NCBI Protein Information
arsenite methyltransferase
UniProt Protein Name
Arsenite methyltransferase
UniProt Gene Name
AS3MT
UniProt Synonym Gene Names
CYT19
UniProt Entry Name
AS3MT_HUMAN

NCBI Description

AS3MT catalyzes the transfer of a methyl group from S-adenosyl-L-methionine (AdoMet) to trivalent arsenical and may play a role in arsenic metabolism (Lin et al., 2002 [PubMed 11790780]).[supplied by OMIM, Mar 2008]

Uniprot Description

AS3MT: Catalyzes the transfer of a methyl group from AdoMet to trivalent arsenicals producing methylated and dimethylated arsenicals. It methylates arsenite to form methylarsonate, Me- AsO(3)H(2), which is reduced by methylarsonate reductase to methylarsonite, Me-As(OH)2. Methylarsonite is also a substrate and it is converted into the much less toxic compound dimethylarsinate (cacodylate), Me(2)As(O)-OH. Belongs to the methyltransferase superfamily.

Protein type: Methyltransferase; Mitochondrial; EC 2.1.1.137

Chromosomal Location of Human Ortholog: 10q24.32

Cellular Component: mitochondrion; cytoplasm; cytosol

Molecular Function: arsenite methyltransferase activity; methylarsonite methyltransferase activity; S-adenosylmethionine-dependent methyltransferase activity

Biological Process: methylation; arsonoacetate metabolic process; toxin metabolic process

Research Articles on AS3MT

Similar Products

Product Notes

The AS3MT as3mt (Catalog #AAA9140738) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The AS3MT Polyclonal Antibody reacts with Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's AS3MT can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1:500-1:2000. Researchers should empirically determine the suitability of the AS3MT as3mt for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "AS3MT, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.