Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western blot-ARL4D Polyclonal Antibody)

Rabbit ARL4D Polyclonal Antibody | anti-ARL4D antibody

ARL4D Polyclonal Antibody

Gene Names
ARL4D; ARL6; ARF4L
Reactivity
Human, Mouse, Rat
Applications
Western Blot, Immunohistochemistry, Immunofluorescence
Purity
Affinity Purification
Synonyms
ARL4D; Polyclonal Antibody; ARL4D Polyclonal Antibody; ARF4L; ARL6; ADP ribosylation factor like GTPase 4D; anti-ARL4D antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity Purification
Form/Format
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Concentration
3.05 mg/ml (varies by lot)
Sequence Length
201
Applicable Applications for anti-ARL4D antibody
Western Blot (WB), Immunohistochemistry (IHC), Immunofluorescence (IF)
Application Notes
WB: 1:500-1:2000
IHC: 1:50-1:100
IF: 1:50-1:100
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 92-201 of human ARL4D (NP_001652.2).
Immunogen Sequence
RRTDGLVFVVDAAEAERLEEAKVELHRISRASDNQGVPVLVLANKQDQPGALSAAEVEKRLAVRELAAATLTHVQGCSAVDGLGLQQGLERLYEMILKRKKAARGGKKRR
Cellular Location
Golgi Apparatus, Lipid-Anchor, Membrane
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

Western Blot (WB)

(Western blot-ARL4D Polyclonal Antibody)

Western Blot (WB) (Western blot-ARL4D Polyclonal Antibody)
Related Product Information for anti-ARL4D antibody
ADP-ribosylation factor 4D is a member of the ADP-ribosylation factor family of GTP-binding proteins. ARL4D is closely similar to ARL4A and ARL4C and each has a nuclear localization signal and an unusually high guanine nucleotide exchange rate. This protein may play a role in membrane-associated intracellular trafficking. Mutations in this gene have been associated with Bardet-Biedl syndrome (BBS).

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
379
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
ADP-ribosylation factor-like protein 4D
NCBI Official Synonym Full Names
ADP ribosylation factor like GTPase 4D
NCBI Official Symbol
ARL4D
NCBI Official Synonym Symbols
ARL6; ARF4L
NCBI Protein Information
ADP-ribosylation factor-like protein 4D
UniProt Protein Name
ADP-ribosylation factor-like protein 4D
UniProt Gene Name
ARL4D
UniProt Synonym Gene Names
ARF4L
UniProt Entry Name
ARL4D_HUMAN

NCBI Description

ADP-ribosylation factor 4D is a member of the ADP-ribosylation factor family of GTP-binding proteins. ARL4D is closely similar to ARL4A and ARL4C and each has a nuclear localization signal and an unusually high guanine nucleotide exchange rate. This protein may play a role in membrane-associated intracellular trafficking. Mutations in this gene have been associated with Bardet-Biedl syndrome (BBS). [provided by RefSeq, Jul 2008]

Uniprot Description

ARL4D: Small GTP-binding protein which cycles between an inactive GDP-bound and an active GTP-bound form, and the rate of cycling is regulated by guanine nucleotide exchange factors (GEF) and GTPase-activating proteins (GAP). GTP-binding protein that does not act as an allosteric activator of the cholera toxin catalytic subunit. Recruits CYTH1, CYTH2, CYTH3 and CYTH4 to the plasma membrane in GDP-bound form. Belongs to the small GTPase superfamily. Arf family.

Protein type: G protein, monomeric; Nucleolus; G protein, monomeric, ARF; G protein

Chromosomal Location of Human Ortholog: 17q21.31

Cellular Component: cytoplasm; nucleolus; plasma membrane

Molecular Function: GTPase activity; protein binding; GTP binding

Biological Process: metabolic process; small GTPase mediated signal transduction; protein secretion

Research Articles on ARL4D

Similar Products

Product Notes

The ARL4D arl4d (Catalog #AAA9140984) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ARL4D Polyclonal Antibody reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's ARL4D can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB), Immunohistochemistry (IHC), Immunofluorescence (IF). WB: 1:500-1:2000 IHC: 1:50-1:100 IF: 1:50-1:100. Researchers should empirically determine the suitability of the ARL4D arl4d for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "ARL4D, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.