Western Blot (WB)
(Host: RabbitTarget Name: DPEP2Sample Type: OVCAR-3 Whole Cell lysatesAntibody Dilution: 1.0ug/mlDPEP2 is supported by BioGPS gene expression data to be expressed in OVCAR3)
Rabbit DPEP2 Polyclonal Antibody | anti-DPEP2 antibody
DPEP2 Antibody - C-terminal region
Gene Names
DPEP2; MBD2
Reactivity
Human, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
DPEP2; Polyclonal Antibody; DPEP2 Antibody - C-terminal region; anti-DPEP2 antibody
Host
Rabbit
Reactivity
Human, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: VFRQVEKVQEENKWQSPLEDKFPDEQLSSSCHSDLSRLRQRQSLTSGQEL
Sequence Length
399
Applicable Applications for anti-DPEP2 antibody
Western Blot (WB)
Homology
Human: 100%; Rabbit: 86%; Rat: 79%
Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Human DPEP2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(Host: RabbitTarget Name: DPEP2Sample Type: OVCAR-3 Whole Cell lysatesAntibody Dilution: 1.0ug/mlDPEP2 is supported by BioGPS gene expression data to be expressed in OVCAR3)
Western Blot (WB)
(Host: RabbitTarget Name: DPEP2Sample Type: OVCAR-3 Whole Cell lysatesAntibody Dilution: 1.0ug/mlDPEP2 is supported by BioGPS gene expression data to be expressed in OVCAR3)
Related Product Information for anti-DPEP2 antibody
This is a rabbit polyclonal antibody against DPEP2. It was validated on Western Blot
Target Description: DPEP2 belongs to the membrane-bound dipeptidase (EC 3.4.13.19) family. These enzymes hydrolyze a variety of dipeptides, including leukotriene D4, the beta-lactam ring of some antibiotics, and cystinyl-bis-glycine (cys-bis-gly) formed during glutathione degradation.
Target Description: DPEP2 belongs to the membrane-bound dipeptidase (EC 3.4.13.19) family. These enzymes hydrolyze a variety of dipeptides, including leukotriene D4, the beta-lactam ring of some antibiotics, and cystinyl-bis-glycine (cys-bis-gly) formed during glutathione degradation.
Product Categories/Family for anti-DPEP2 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
43kDa
NCBI Official Full Name
DPEP2 protein
NCBI Official Synonym Full Names
dipeptidase 2
NCBI Official Symbol
DPEP2
NCBI Official Synonym Symbols
MBD2
NCBI Protein Information
dipeptidase 2
UniProt Protein Name
Dipeptidase 2
Protein Family
UniProt Gene Name
DPEP2
NCBI Description
DPEP2 belongs to the membrane-bound dipeptidase (EC 3.4.13.19) family. These enzymes hydrolyze a variety of dipeptides, including leukotriene D4, the beta-lactam ring of some antibiotics, and cystinyl-bis-glycine (cys-bis-gly) formed during glutathione degradation (Habib et al., 2003 [PubMed 12738806]).[supplied by OMIM, Mar 2008]
Uniprot Description
Probable metalloprotease which hydrolyzes leukotriene D4 (LTD4) into leukotriene E4 (LTE4).
Similar Products
Product Notes
The DPEP2 dpep2 (Catalog #AAA3215630) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The DPEP2 Antibody - C-terminal region reacts with Human, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's DPEP2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the DPEP2 dpep2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: VFRQVEKVQE ENKWQSPLED KFPDEQLSSS CHSDLSRLRQ RQSLTSGQEL. It is sometimes possible for the material contained within the vial of "DPEP2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
