Rabbit anti-Human ARL4D Polyclonal Antibody | anti-ARL4D antibody

ARL4D (ADP-ribosylation Factor-like 4D, ADP-ribosylation Factor-like Protein 4D, ADP-ribosylation Factor-like Protein 4L, ARF4L, ARL6) (FITC)

Cat. Num. AAA6370345

• Gene Names: ARL4D; ARL6; ARF4L
• Reactivity: Human
• Applications: Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: ARL4D; Polyclonal Antibody; ARL4D (ADP-ribosylation Factor-like 4D; ADP-ribosylation Factor-like Protein 4D; ADP-ribosylation Factor-like Protein 4L; ARF4L; ARL6) (FITC); anti-ARL4D antibody

• Host: Rabbit
• Reactivity: Human
• Clonality: Polyclonal
• Isotype: IgG
• Specificity: Recognizes human ARL4D.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein Isothiocyanate (FITC).

• Applicable Applications for anti-ARL4D antibody: Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Full length human ARL4D, aa1-201 (NP_001652.2).
• Immunogen Sequence: MGNHLTEMAPTASSFLPHFQALHVVVIGLDSAGKTSLLYRLKFKEFVQSVPTKGFNTEKIRVPLGGSRGITFQVWDVGGQEKLRPLWRSYTRRTDGLVFVVDAAEAERLEEAKVELHRISRASDNQGVPVLVLANKQDQPGALSAAEVEKRLAVRELAAATLTHVQGCSAVDGLGLQQGLERLYEMILKRKKAARGGKKRR
• Conjugate: FITC
• Note: Preservative Free
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of ARL4D expression in transfected 293T cell line by ARL4D polyclonal antibody. Lane 1: ARL4D transfected lysate (22.2kD). Lane 2: Non-transfected lysate.)

Related Product Information for anti-ARL4D antibody

ADP-ribosylation factor 4D is a member of the ADP-ribosylation factor family of GTP-binding proteins. ARL4D is closely similar to ARL4A and ARL4C and each has a nuclear localization signal and an unusually high guanine nucleotide exchange rate. This protein may play a role in membrane-associated intracellular trafficking. Mutations in this gene have been associated with Bardet-Biedl syndrome (BBS).

Product Categories/Family for anti-ARL4D antibody

Antibodies; Transport Proteins

NCBI and Uniprot Product Information

• NCBI GI #: 41327767
• NCBI GeneID: 379
• NCBI Accession #: NP_001652.2
• NCBI GenBank Nucleotide #: NM_001661
• UniProt Accession #: P49703; B2RC59; D3DX43
• Molecular Weight: 22,156 Da
• NCBI Official Full Name: ADP-ribosylation factor-like protein 4D
• NCBI Official Synonym Full Names: ADP-ribosylation factor-like 4D
• NCBI Official Symbol: ARL4D
• NCBI Official Synonym Symbols: ARL6; ARF4L
• NCBI Protein Information: ADP-ribosylation factor-like protein 4D; ADP-ribosylation factor-like 6; ADP-ribosylation factor-like protein 4L
• UniProt Protein Name: ADP-ribosylation factor-like protein 4D
• Protein Family: ADP-ribosylation factor-like protein
• UniProt Gene Name: ARL4D
• UniProt Synonym Gene Names: ARF4L
• UniProt Entry Name: ARL4D_HUMAN

NCBI Description

ADP-ribosylation factor 4D is a member of the ADP-ribosylation factor family of GTP-binding proteins. ARL4D is closely similar to ARL4A and ARL4C and each has a nuclear localization signal and an unusually high guanine nucleotide exchange rate. This protein may play a role in membrane-associated intracellular trafficking. Mutations in this gene have been associated with Bardet-Biedl syndrome (BBS). [provided by RefSeq, Jul 2008]

Uniprot Description

ARL4D: Small GTP-binding protein which cycles between an inactive GDP-bound and an active GTP-bound form, and the rate of cycling is regulated by guanine nucleotide exchange factors (GEF) and GTPase-activating proteins (GAP). GTP-binding protein that does not act as an allosteric activator of the cholera toxin catalytic subunit. Recruits CYTH1, CYTH2, CYTH3 and CYTH4 to the plasma membrane in GDP-bound form. Belongs to the small GTPase superfamily. Arf family.

Protein type: G protein, monomeric; Nucleolus; G protein, monomeric, ARF; G protein

Chromosomal Location of Human Ortholog: 17q21.31

Cellular Component: cytoplasm; nucleolus; plasma membrane

Molecular Function: GTPase activity; protein binding; GTP binding

Biological Process: metabolic process; small GTPase mediated signal transduction; protein secretion