Western Blot (WB)
(Host: RabbitTarget Name: ARHGEF19Sample Tissue: Human RPMI 8226 Whole CellAntibody Dilution: 1ug/ml)
Rabbit ARHGEF19 Polyclonal Antibody | anti-ARHGEF19 antibody
ARHGEF19 antibody - middle region
Gene Names
ARHGEF19; WGEF
Reactivity
Cow, Horse, Human, Mouse, Pig, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
ARHGEF19; Polyclonal Antibody; ARHGEF19 antibody - middle region; anti-ARHGEF19 antibody
Host
Rabbit
Reactivity
Cow, Horse, Human, Mouse, Pig, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: RFLLNSVLYQEYSDVASARELRRQQREEEGPGDEAEGAEEGPGPPRANLS
Sequence Length
802
Applicable Applications for anti-ARHGEF19 antibody
Western Blot (WB)
Homology
Cow: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human ARHGEF19
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(Host: RabbitTarget Name: ARHGEF19Sample Tissue: Human RPMI 8226 Whole CellAntibody Dilution: 1ug/ml)
Western Blot (WB)
(Host: RabbitTarget Name: ARHGEF19Sample Tissue: Human RPMI 8226 Whole CellAntibody Dilution: 1ug/ml)
Western Blot (WB)
(WB Suggested Anti-ARHGEF19 Antibody Titration: 0.2-1 ug/mlPositive Control: Hela cell lysate)
Western Blot (WB)
(WB Suggested Anti-ARHGEF19 Antibody Titration: 0.2-1 ug/mlPositive Control: Hela cell lysate)
Related Product Information for anti-ARHGEF19 antibody
This is a rabbit polyclonal antibody against ARHGEF19. It was validated on Western Blot
Target Description: Guanine nucleotide exchange factors (GEFs) such as ARHGEF19 accelerate the GTPase activity of Rho GTPases (see RHOA, MIM 165390).
Target Description: Guanine nucleotide exchange factors (GEFs) such as ARHGEF19 accelerate the GTPase activity of Rho GTPases (see RHOA, MIM 165390).
Product Categories/Family for anti-ARHGEF19 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
89kDa
NCBI Official Full Name
rho guanine nucleotide exchange factor 19
NCBI Official Synonym Full Names
Rho guanine nucleotide exchange factor 19
NCBI Official Symbol
ARHGEF19
NCBI Official Synonym Symbols
WGEF
NCBI Protein Information
rho guanine nucleotide exchange factor 19
UniProt Protein Name
Rho guanine nucleotide exchange factor 19
Protein Family
UniProt Gene Name
ARHGEF19
UniProt Entry Name
ARHGJ_HUMAN
NCBI Description
Guanine nucleotide exchange factors (GEFs) such as ARHGEF19 accelerate the GTPase activity of Rho GTPases (see RHOA, MIM 165390).[supplied by OMIM, Dec 2008]
Uniprot Description
ARHGEF19: Acts as guanine nucleotide exchange factor (GEF) for RhoA GTPase. 2 isoforms of the human protein are produced by alternative splicing.
Protein type: GEFs, Rac/Rho; GEFs
Chromosomal Location of Human Ortholog: 1p36.13
Molecular Function: protein binding; Rho guanyl-nucleotide exchange factor activity; GTPase activator activity
Biological Process: wound healing; regulation of actin cytoskeleton organization and biogenesis
Research Articles on ARHGEF19
Similar Products
Product Notes
The ARHGEF19 arhgef19 (Catalog #AAA3211151) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ARHGEF19 antibody - middle region reacts with Cow, Horse, Human, Mouse, Pig, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's ARHGEF19 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the ARHGEF19 arhgef19 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: RFLLNSVLYQ EYSDVASARE LRRQQREEEG PGDEAEGAEE GPGPPRANLS. It is sometimes possible for the material contained within the vial of "ARHGEF19, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
