Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: VAV3Sample Type: Fetal LungAntibody Dilution: 1.0ug/ml)

Rabbit anti-Human VAV3 Polyclonal Antibody | anti-VAV3 antibody

VAV3 Antibody - C-terminal region

Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
VAV3; Polyclonal Antibody; VAV3 Antibody - C-terminal region; anti-VAV3 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: EIIDLQQYKIANNPTTDKENKKWSYGFYLIHTQGQNGLEFYCKTKDLKKK
Sequence Length
847
Applicable Applications for anti-VAV3 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Human VAV3
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: VAV3Sample Type: Fetal LungAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: VAV3Sample Type: Fetal LungAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-VAV3 antibody
This is a rabbit polyclonal antibody against VAV3. It was validated on Western Blot

Target Description: This gene is a member of the VAV gene family. The VAV proteins are guanine nucleotide exchange factors (GEFs) for Rho family GTPases that activate pathways leading to actin cytoskeletal rearrangements and transcriptional alterations. This gene product acts as a GEF preferentially for RhoG, RhoA, and to a lesser extent, RAC1, and it associates maximally with the nucleotide-free states of these GTPases. Alternatively spliced transcript variants encoding different isoforms have been described for this gene.
Product Categories/Family for anti-VAV3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
93 kDa
NCBI Official Full Name
guanine nucleotide exchange factor VAV3 isoform 2
NCBI Official Synonym Full Names
vav guanine nucleotide exchange factor 3
NCBI Official Symbol
VAV3
NCBI Protein Information
guanine nucleotide exchange factor VAV3
UniProt Protein Name
Guanine nucleotide exchange factor VAV3
UniProt Gene Name
VAV3
UniProt Synonym Gene Names
VAV-3
UniProt Entry Name
VAV3_HUMAN

NCBI Description

This gene is a member of the VAV gene family. The VAV proteins are guanine nucleotide exchange factors (GEFs) for Rho family GTPases that activate pathways leading to actin cytoskeletal rearrangements and transcriptional alterations. This gene product acts as a GEF preferentially for RhoG, RhoA, and to a lesser extent, RAC1, and it associates maximally with the nucleotide-free states of these GTPases. Alternatively spliced transcript variants encoding different isoforms have been described for this gene. [provided by RefSeq, Jul 2008]

Uniprot Description

VAV3: a guanine nucleotide exchange factor (GEF) that activates RhoA, RhoG and, to a lesser extent, Rac1. Binds physically to the nucleotide-free states of those GTPases. Plays an important role in angiogenesis. Its recruitment by activated EPHA2 is critical for EFNA1-induced RAC1 GTPase activation and vascular endothelial cell migration and assembly. May be important for integrin-mediated signaling, at least in some cell types. In osteoclasts, along with SYK tyrosine kinase, required for signaling through integrin alpha-v/beta-1 (ITAGV-ITGB1), a crucial event for osteoclast proper cytoskeleton organization and function. This signaling pathway involves RAC1, but not RHO, activation. Necessary for proper wound healing. In the course of wound healing, required for the phagocytotic cup formation preceding macrophage phagocytosis of apoptotic neutrophils. Responsible for integrin beta-2 (ITGB2)-mediated macrophage adhesion and, to a lesser extent, contributes to beta-3 (ITGB3)-mediated adhesion. Does not affect integrin beta-1 (ITGB1)-mediated adhesion. Interacts with the PH domain of APS. Interacts (via SH2 domains) with the phosphorylated form of EPHA2. Interacts with ROS1; constitutive interaction that mediates VAV3 phosphorylation. Down-regulated by EGF and TGF-beta. Four isoforms of the human protein are produced by alternative promoter. Isoform 1 and isoform 3 are widely expressed; both are expressed at very low levels in skeletal muscle. In keratinocytes, isoform 1 is less abundant than isoform 3. Isoform 3 is detected at very low levels, if any, in adrenal gland, bone marrow, spleen, fetal brain and spinal chord; in these tissues, isoform 1 is readily detectable.

Protein type: Motility/polarity/chemotaxis; Nuclear receptor co-regulator; Adaptor/scaffold; Actin-binding; GEFs, Rac/Rho; GEFs

Chromosomal Location of Human Ortholog: 1p13.3

Cellular Component: plasma membrane; cytosol

Molecular Function: protein binding; SH3/SH2 adaptor activity; metal ion binding; Rac guanyl-nucleotide exchange factor activity; guanyl-nucleotide exchange factor activity; GTPase activator activity; epidermal growth factor receptor binding

Biological Process: response to drug; lamellipodium biogenesis; integrin-mediated signaling pathway; platelet activation; neutrophil chemotaxis; axon guidance; positive regulation of cell adhesion; positive regulation of signal transduction; nerve growth factor receptor signaling pathway; positive regulation of apoptosis; positive regulation of phosphoinositide 3-kinase activity; vesicle fusion; regulation of small GTPase mediated signal transduction; B cell receptor signaling pathway; small GTPase mediated signal transduction; ephrin receptor signaling pathway; positive regulation of B cell proliferation; innate immune response; angiogenesis; blood coagulation; vascular endothelial growth factor receptor signaling pathway; response to DNA damage stimulus

Research Articles on VAV3

Similar Products

Product Notes

The VAV3 vav3 (Catalog #AAA3219630) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The VAV3 Antibody - C-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's VAV3 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the VAV3 vav3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: EIIDLQQYKI ANNPTTDKEN KKWSYGFYLI HTQGQNGLEF YCKTKDLKKK. It is sometimes possible for the material contained within the vial of "VAV3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.